KEGG   Cyanobacterium endosymbiont of Epithemia turgida: ETSB_1350Help
Entry
ETSB_1350         CDS       T03622                                 

Gene name
ccmA
Definition
(GenBank) 3-deoxy-7-phosphoheptulonate synthase
  KO
K03856  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
ceo  Cyanobacterium endosymbiont of Epithemia turgida
Pathway
ceo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ceo01100  Metabolic pathways
ceo01110  Biosynthesis of secondary metabolites
ceo01130  Biosynthesis of antibiotics
ceo01230  Biosynthesis of amino acids
Module
ceo_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:ceo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ETSB_1350 (ccmA)
Enzymes [BR:ceo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     ETSB_1350 (ccmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1 DAHP_snth_FXD NeuB
Motif
Other DBs
NCBI-ProteinID: BAP18100
UniProt: A0A077JFV7
LinkDB All DBs
Position
1968023..1969084
Genome map
AA seq 353 aa AA seqDB search
MIIVMKSGSPEAEIERIIEEVKQINLTPEKITGAQQVVIGLVGETATLELSRIEELSLWI
QEVLRVGKPFKRASLEFRHGHHSEVLVNTPNEVVTFGKNHPVVVVAGPCSVENEEMIIGT
AMQVKAAGAKFLRGGAYKPRTSPYAFQGHGESALGLLAAAREASGLGIITEVMDTADVDK
VAEVADVVQIGARNMQNFALLKKVGSQNKPVLLKRGMAATIDDWLMAAEYVLAAGNSNLI
LCERGIRTFDQKYTRNTLDFSAIPVLRSLTHLPIMIDPSHGTGKSDYVPSMAAAAIAAGT
DSLMIEVHPNPAKALSDGPQSLTPERFDRLMQELSVMGNTVGRWSQPKAVFAQ
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgattattgttatgaaatcaggttctccagaagctgaaatcgaacggattattgaagaa
gttaaacagatcaacctgacccccgaaaaaattacaggtgctcaacaagttgtcattggc
ttggtgggagaaacagctactcttgaactttctcgcattgaagaattaagtctttggatt
caagaggtgttacgagtcggtaaacctttcaaacgggcgagtctcgaatttcgccatgga
catcatagtgaagtgttagttaatactcctaatgaagtagtaacctttggcaaaaatcat
cccgtagtggtggttgccggtccttgttctgtggaaaatgaagaaatgattatcggaact
gccatgcaagttaaggccgcaggagcgaagtttttgcgaggaggagcttataaacctcgt
acttctccttatgcctttcaaggtcatggagaaagtgctttaggattattggcagccgcg
cgagaagctagtggactcggaatcattaccgaagtcatggataccgccgatgtggataag
gtagccgaagttgctgatgttgtgcaaattggagctagaaatatgcagaactttgctctc
ctgaaaaaagtgggctctcagaataaacctgtgttattgaagcggggaatggcagctact
atcgatgattggttaatggcagctgagtatgtactagcagcaggaaatagtaatcttatt
ctctgtgaacgaggaattcgtacttttgatcaaaaatatacccgtaatactttagatttt
tcagctattccagtgttacggtctttaacccatttgccgataatgattgatccgagtcat
ggaactggcaaatcagattatgtgccgtctatggctgctgcggcgatcgccgcagggaca
gactctttgatgattgaagttcatcccaacccggctaaagctttatctgatggtcctcaa
tctttaaccccagaaagatttgaccgcttgatgcaggagttatccgtaatgggcaataca
gtgggtcgttggagtcaacctaaagctgtttttgcccaataa

DBGET integrated database retrieval system