KEGG   Crinalium epipsammum: Cri9333_0948Help
Entry
Cri9333_0948      CDS       T02373                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase, type 1
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cep  Crinalium epipsammum
Pathway
cep00620  Pyruvate metabolism
cep00680  Methane metabolism
cep00710  Carbon fixation in photosynthetic organisms
cep01100  Metabolic pathways
cep01120  Microbial metabolism in diverse environments
cep01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Cri9333_0948
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Cri9333_0948
   00680 Methane metabolism
    Cri9333_0948
Enzymes [BR:cep01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Cri9333_0948
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: AFZ11863
UniProt: K9VUS5
LinkDB All DBs
Position
complement(1063139..1066273)
Genome map
AA seq 1044 aa AA seqDB search
MSSLLHTHDQELTVTSASDLFLRHRLKVVEDLWESVLRQECGQELVDLLKQLRSLCSPEG
QTPELPETSVPKLIEKLDLNSAIRASRAFALYFQLINIVEQHYEQREQQLSLRANHHLPA
TNKAVLPPTSATISPAPNIGDLEELQPNSPNNNLGADLLEKTLQDNGVPPRDQGTFHWLF
PYLRSMNVPPQHIQRLLNNLEIRLVFTAHPTEIVRHTIRGKQRRIAHLLQQLDQAEEGMN
SLGLNYSLEAETFEEQLTEEIRLWWRTDELHQFKPTVIDEVDYTLHYFEQVLFEAIPQLS
RRLKQALKDSFPWLTPPNHKFCQFGSWVGSDRDGNPSVTPEVTWQTACYQRGVVLEKYIQ
SLRQLTDLLSLSLHWSDVLPELLESLEQDRGRMPEVYDRLAIRYRQEPYRLKLAYILARL
ENSRDRNSQLAYGDHQKWQNSDTYAKSFYRTGEEFLAELQLIQHNLKETGLSCRDLENLI
CQVEIYGFNLAYLDIRQESSRHSDTINEIVEYLQVLHKPYNELTETERSLWLATELQTKR
PLIPSELPFSQKTSETVESFRMLRQLHQEFGSPICQTYVISMSHDVSDLLEVLLLAKEAG
LYDPRTGITSLQVVPLFETVEDLKRAPAVMEALFELPFYRALLAGGYEVAQANSEQTQPQ
IINSQSQTPIKSSSAITPHLQEVMLGYSDSNKDSGFLSSNWEIHKAQKALQKIAEKYNLN
LRIFHGRGGSVGRGGGPAYEAILAQPGHTIKGRIKITEQGEVLASKYSLPELALYNLETV
TTAVIKASLLGTSFDDIQPWNEIMEELSVRSRAHYRSLIYEQTDLVDFFHQVTPIEEISQ
LQISSRPARRGGKKDLASLRAIPWVFSWTQSRFLLPSWYGVGTALQEFLNEEPDENLNLL
RYFYFKWPFFKMAISRVEMTLAKVDLQMAHHYVRELSKPEDIERFEALFDQIAKEYNLVC
ELVLTITGHKRLLDGDPELQRSVQLRNGSIVPLGFLQVSLLKRLREHGKLTTTGVVHSRY
SKGELLRGALLTINGIAAGMRNTG
NT seq 3135 nt NT seq  +upstreamnt  +downstreamnt
atgagttcgctactccatacgcacgatcaggaattgacggtaacatctgcctctgatcta
tttctgcgccatcgtctcaaggttgtagaggacttatgggagtctgttctgcgacaggag
tgcggtcaggaactggtcgatttgctcaagcaattgcgctctctttgttcaccagagggg
cagactcctgaattgccagaaacctcagtaccaaagctgattgaaaaacttgacctcaat
tcagcaattagggcttcccgcgcttttgccctatatttccaactgattaatattgttgaa
cagcactacgagcaacgggaacaacagctttcactgcgggctaatcaccatcttccggcg
acaaataaggctgtattaccaccaacatcagccacaatttcccctgcgcctaatattggc
gacttagaggagttgcagcctaattctcccaacaataatttgggagcagacttgctggaa
aaaactttgcaagacaatggtgtaccacctagagatcaaggtactttccattggctattc
ccctacttgcgctctatgaatgtgccaccgcaacacatccagcgcctactgaacaatcta
gagattagattagtatttaccgctcacccgacagaaattgttcgccataccatcaggggc
aaacagcgacgaattgctcatcttctgcaacaactagatcaagcagaagaaggcatgaac
agcttaggtttaaattattccttggaagctgaaacctttgaagaacaactaactgaagaa
attagattgtggtggcgcactgatgagttgcatcaatttaagccaacggtgatcgatgag
gtagattacactcttcactattttgagcaagttttatttgaggcaattcctcaactctct
cgccgcttaaaacaagctttaaaggattcttttccctggttgactcctccaaatcataaa
ttctgccagttcggttcttgggtaggttcagaccgtgatggtaatccatcggtaacacca
gaagttacttggcaaactgcttgttaccaacggggtgtggtgctggaaaaatatatccaa
tctttacggcaacttacggatcttttaagcttatcgttgcactggagcgatgttttacca
gagttactagaatctttggaacaggatcgcggacggatgccagaagtatacgatcgccta
gcaattcgctacaggcaagaaccttacaggctgaagttggcttatatcttggcacggtta
gaaaatagtcgcgatcgcaattcgcaacttgcctatggcgatcatcaaaaatggcaaaac
tcagacacctacgctaaaagtttttaccgcactggtgaagagtttttagcagagttgcaa
ttaattcagcacaacctgaaagaaacaggcttaagttgccgtgatttagaaaacttgatt
tgtcaggtggaaatttacggatttaatctggcatatctggatattcgtcaagaaagttct
cgccattcggatactatcaacgaaattgttgaatatctccaagttttacataagccttat
aacgagcttacagaaacggagcgatcgctttggttggcaacagaactgcaaactaaacgc
ccattaattccatctgaactgccattttcccaaaagacttctgaaacagttgaaagcttc
cgaatgctgcggcagttacatcaagagtttggctctccaatctgccaaacttacgtgatc
agcatgagccatgatgttagcgaccttttagaggtgttgctactagctaaggaagctggt
ttatatgaccccaggacaggtatcactagcttgcaggtagtaccgttatttgaaacggtt
gaagatttgaaacgcgccccagcagtgatggaagcgctgtttgaattgcctttctatcgg
gcattacttgctggaggttatgaagttgctcaagctaatagcgaacaaacacaaccccaa
attattaattctcaatcccaaacaccaataaaatcttcatcagctatcacacctcactta
caagaagtgatgcttggttattctgatagcaataaagattctggtttcttaagcagtaat
tgggaaattcacaaagctcaaaaagctttgcagaaaattgcagaaaagtataatcttaat
ttacgcatttttcacgggcgcggtggttccgtaggtcgtggtggtggacctgcttatgaa
gcgattttggctcaaccaggtcatacaattaaaggcaggattaagattacagaacaggga
gaagtattagcttctaaatactctctaccagaattagctttgtataatctcgaaacagtt
acaacggctgtgattaaagcgagtttgctcggaaccagctttgatgatattcagccttgg
aacgaaattatggaagaattgtcagtgcgatcgcgggctcattatcgctccctaatttat
gaacaaacagatttagtagacttcttccaccaagtcacaccaattgaagaaattagccaa
ctgcaaattagttctcgtcccgcccgtcgtggtggtaagaaagatttagccagtttgcgg
gctatcccttgggtatttagctggacgcaaagccgtttcctactaccttcttggtatggt
gttggtacagccttgcaggagtttttaaacgaagaaccagacgaaaacctcaacctgctg
cgctacttttacttcaaatggccgttctttaaaatggcaatctctagagtagagatgact
ttagcaaaagttgatctacagatggctcaccattacgtgcgtgaactatctaaacctgaa
gatattgaacgttttgaagctttgtttgatcagattgccaaagaatacaatttggtttgc
gaacttgtgctgactattactggtcataagcggcttttagacggagacccagaattgcag
cgttctgtacagttacgaaatggtagcattgtacctctgggtttcttacaagtttctttg
ttgaaacgtctgcgagaacacggcaagcttacgacaactggtgttgtacactcccgatat
agtaagggtgaattgctacgtggagccttattaactatcaacgggattgctgctggtatg
cgaaatacaggctga

DBGET integrated database retrieval system