KEGG   Crinalium epipsammum: Cri9333_1305Help
Entry
Cri9333_1305      CDS       T02373                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cep  Crinalium epipsammum
Brite
Enzymes [BR:cep01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Cri9333_1305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AFZ12204
UniProt: K9VXC7
LinkDB All DBs
Position
1481866..1482462
Genome map
AA seq 198 aa AA seqDB search
MAFEQPPLPYDFNALEPHMSAKTFEFHYGKHHAAYVTNLNKLVQDTEMADKSLEEVIKAS
FGDSSKTGIFNNAAQVWNHTFFWNCMKPNGGGQPTGELADKINTAFGSFDKFKEEFKNAA
VTQFGSGWAWLVKDGDTLKITKTPNAENPLAHGQTALLTVDVWEHAYYLDYQNRRPDFVQ
TVLDNLINWDFVTQNLSA
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgaacaaccacccttaccatacgactttaacgctctagagccgcatatgtcg
gcaaaaacctttgaattccattacggcaagcaccacgcggcttacgttacaaacctcaac
aaattggtacaagataccgaaatggctgacaagtcacttgaggaagttattaaggcaagc
ttcggtgattcgtccaaaactggtattttcaacaacgccgcccaagtttggaaccacacc
ttcttctggaattgcatgaagccaaatggtggtggacaaccaactggcgagttagcagat
aaaatcaatactgcttttggtagcttcgataaatttaaagaagagttcaaaaacgctgct
gtaacccaatttggtagcggctgggcttggctagttaaggacggtgataccctcaaaatt
accaaaacccctaacgcagaaaatcccctagctcacgggcaaactgccttgctaacagtt
gatgtttgggaacacgcttattaccttgactaccaaaaccgtcgtcccgacttcgtacaa
actgtgctagacaacttgattaactgggatttcgttacccaaaatctgtctgcataa

DBGET integrated database retrieval system