KEGG   Crinalium epipsammum: Cri9333_1599Help
Entry
Cri9333_1599      CDS       T02373                                 

Definition
(GenBank) multi-sensor signal transduction multi-kinase
Organism
cep  Crinalium epipsammum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_16 Pkinase Pkinase_Tyr HATPase_c GAF GAF_2 HisKA GAF_3 Zeta_toxin HATPase_c_3 DUF815 RsgA_GTPase Sigma54_activat Pkinase_fungal
Motif
Other DBs
NCBI-ProteinID: AFZ12489
UniProt: K9VY61
LinkDB All DBs
Position
complement(1822398..1827818)
Genome map
AA seq 1806 aa AA seqDB search
MIAISGYKIIEKIYDGVETGVYRAQPDLEENTVIIKILKAKYPTLKEITQLRHEYDISKN
LDFAGIIKTYKLENYQNGLFLVLEDLGGLDLKKFLDTHKIDLKDFCEIALQLTDALTVLY
EHHIIHKDIKPHNIIIQPITKQVKITDFSIASRLSRENPTINNPNGMEGTLTYISPEQTG
RMNRSIDYRTDFYSLGVTFYEMLTGEVPFKSSEPIELVHAHIAKKPIPPIELNPEIPQVI
SDIVMKLLAKTAEDRYQSALGIKADLEICLNELQNTGSISNFTPGQEDLFAQFVIPQKLY
GRETEVATLMAAFERASQGSAEMMLVSGYSGIGKSSLVNEVHKPIVRDRGYFISGKFDQF
KRNIPYASVIEAFQDLIRQLLTETSAKIANWKEKLLNALGENGQVITEVLPDVELIIGEQ
PDVPKLGATESQNRFNRVFQNFSHVFSTKEHPLVLFLDDLQWADSASLKLIQLLITDPDS
QYLLFIGAYRDNEVSPTHPLILTLEEIQKLGSTINNIVLTPLDISHVRELVADTLHDQIN
RSQPLANLVFNKTQGNPFFLTQLLQSLYEEKLLTFDFNVGNWQWNIEQIQGIGITDYSVV
QLLAKNIQKLPKSTQRVLKLAACIGNTFNLDVLAIINEKSQPETAEDLWSSLQAGLILPL
NEAYKIPLSFDENKSGALILQDFKVSYKFLHDRVQQAAYSLIPEAEKKETHLKIGQLLLE
KTNPEERKENIFALVNQLNFGTELITSDAEKYELVELNLIAGIRAKLSNAYEAARKYLNV
ALALIPENSWQNQYELALALYVEAVEVEYLNIDFEQAEKLSEIVITQAKDLLDKIQVYEY
KILFYLAQSQPNVAIELSLQVLEMLNITLAETPPEKLNIEDLVKLPEMQDPHKLAAMRIL
MVLMPAAAFVNPALLPASAFTMVNLSSQHGNSALAAYSYATYALLLCQFLGDIEAGYKFS
QLSLKILEDFNGKKIKAKIFNIVNGFVIHWKAHARETVEPLREGVQVGIETGDIEYACYN
AATYSAYIFYIGEPLNFVNQQQSIYVDMMLKLQQKTQVEYAQIFRQLVFCLSKEVTNKYS
LCGDFFNTAEMLPIFIGNKNFLLVFVTYLANTLISYWFKNYEQAVTNAMQATQYAFAASG
FIHITEHNFYYSLALLGAYPDVENSLQQQYMQQVENNQQAMQLWAENAPANYQHKYDLIN
AEKARILGNIGEAMEYYDRAIKAAKKQQYTQEEGLANELAAEFYFSRGKDKVATTYLTDA
YYCYIHWEATAKVKDLELRYPQIFSQILARKNFSIDLDKTTSLTTAVGTFALDLTTVMKA
SQTLSREILLNDLIEKLMKIVMENAGAQNSCLILDKKGKLVVEATVFVDKNDLVLFPSIP
LEDSETLPLSLINYVARTQENVVLRDAGREGNFITDAYIVKAKLKSILCVPIINQGTVIG
ILYLENNLTAGAFTPERLEVLRILSTQAAISLKNAMLYANLETATEELKVANTKLEEYSR
TLEQKVETRTLELKDKNLRLEQTLTELQQTQTQLIQTEKMSSLGQLVAGIAHEINNPVNF
IHGNILHASEYIDGLLNLVNLYQEQYPNSTPKIQDEIEAIDLEFLREDLPKVIESMQIGS
ERIRQIVLSLRNFSRLDEAEMKKVDIHEGIDSTLLILQHRLKAKSEHSEIKIIKEYGDLP
KVECYPGQLNQVFMNIVSNAIDVLEEYDSKRSGLERQQNPCTIRIHTHLIDGNKVKISIA
DNGSGMREEVRSKIFDPFFTTKSVGSGTGLGLSISYQIVVEKHRGHLECISSPGKGAEFI
ITIPTS
NT seq 5421 nt NT seq  +upstreamnt  +downstreamnt
atgattgccatctcaggttacaaaattatagaaaaaatttacgatggtgtagaaactggc
gtttatcgcgcacaaccagatcttgaagaaaatacagttattattaaaattcttaaagct
aaatatcctaccttaaaagaaattactcaattaagacacgagtatgatatttcaaaaaat
ctcgattttgcaggaatcattaaaacttataaattagagaattatcaaaatggacttttc
cttgtcttagaggacttaggaggattagatctaaaaaaattcctagatactcataaaatt
gacttaaaagatttttgtgaaattgctctacaactaacagatgcactcacagtcttatat
gaacatcacattattcataaagacattaagccacacaatattattattcagccaattacg
aagcaagtaaaaataacagattttagtattgcatcacgtctatctagggaaaaccctact
attaataaccctaatgggatggaaggtactctgacttatatttcgccagagcaaactggt
agaatgaataggtcaattgactaccggacagacttttattcattaggggttactttttat
gaaatgctgacgggagaagtaccttttaaatcatccgaaccaatagaattagttcatgct
catattgctaaaaaaccaattccgcctattgaattaaatccagaaattcctcaagttatc
tctgacattgtgatgaaattgttagccaaaactgctgaggacaggtatcaaagtgcgtta
gggataaaagccgacttagaaatctgcttaaacgaattacaaaatactggcagtattagt
aactttactccaggtcaggaagatttatttgctcaatttgttatcccccaaaaactctat
ggtagagaaacggaagtagctaccttgatggctgcctttgagcgtgccagtcaaggtagt
gccgaaatgatgctagtaagcggttattcaggcatcggtaaatcttctttggttaatgaa
gttcataaacccatcgttcgcgatcgcggttattttatatctggtaagtttgatcaattt
aagcgtaatattccttatgcttccgttattgaagctttccaagatttaattaggcagtta
ctaacagaaacatctgctaaaatcgctaattggaaagaaaaactgcttaatgctttgggt
gaaaatgggcaagtaattactgaagttcttcctgatgttgaattaattattggtgagcaa
ccagatgtgccaaaactgggagctacagaatctcaaaatcgctttaatcgagttttccaa
aactttagtcatgtttttagcaccaaagaacacccactggttttatttttagatgattta
caatgggcagattctgcttctcttaaattaattcagcttttaataactgatcctgatagt
caatacttactatttatcggagcgtatcgcgataacgaagttagccctactcatccatta
attttaacgttggaagaaattcaaaagttgggttcaactatcaataatattgtccttact
cctttagatatttctcacgttcgcgaattagtagcggacactctgcacgatcagataaac
agatcgcagccattagcaaatttagtttttaataaaacccaaggtaatccttttttctta
acacaattactacagtcactttatgaagaaaaactgttaacatttgacttcaatgtaggt
aactggcagtggaatattgagcaaattcaaggaattggaattactgattatagtgtagtt
caactactagctaaaaatattcaaaaactcccgaaaagcacacagagggtattaaaatta
gctgcttgtattggtaacacatttaacttagatgttctggcgatcattaatgaaaaatct
caaccggaaacagcagaggatttgtggtcgtctctgcaagcaggtttaattctccctctt
aatgaagcttacaaaattccgttatcttttgatgaaaataagtcaggagctttaatatta
caagattttaaagtttcctacaaatttctgcatgatcgagtgcaacaagcagcttattcc
ttaattcctgaagctgagaaaaaggaaactcacctaaaaattggtcaactgctgctggaa
aaaactaatccagaggagcggaaagaaaatatttttgccttagttaaccaattaaacttt
ggcactgagttaattaccagtgatgccgaaaaatatgaattggtggaattaaatttaatt
gcaggaattagagctaaattatccaatgcttatgaagcggcacgtaagtatttaaatgtg
gctttagctctaattcctgaaaatagctggcaaaatcagtatgaattggcactggcactt
tatgtagaagctgtagaagttgagtatctcaatattgattttgagcaagcagaaaagctt
tcagaaattgtcataactcaagctaaagatttattagataaaattcaggtatacgaatat
aaaattttattttatcttgctcagagccaacctaatgtggcaatagagttatcgttgcaa
gtgttggaaatgttaaatataacattagcagaaacacctcctgagaaattaaatattgaa
gatttagttaaactaccagaaatgcaagatcctcataaattagctgctatgaggatctta
atggttttaatgcctgctgctgcttttgttaatccagcacttttacctgcgagtgcattt
acaatggtcaatttatctagccagcatggaaattctgcacttgcagcttattcctatgct
acttacgctttattactgtgccaattcttaggagatattgaagctggatataagttctct
caattatctttaaaaatactagaagactttaacggaaaaaaaattaaagctaaaattttc
aatattgtcaatggttttgtaattcattggaaagctcatgctagggaaacagtagaaccg
ctacgtgagggagttcaagtaggtatagaaactggcgatatagaatatgcttgttataat
gcagccacctatagtgcttatatcttttatataggcgaaccgctcaattttgtgaatcag
cagcagtcaatatatgttgatatgatgctgaaattacaacaaaaaacgcaggtagaatat
gcccaaatatttaggcaacttgtattttgtcttagtaaagaagtcacaaataaatatagt
ttatgtggcgatttttttaatacagcagaaatgttgcctatctttatcggaaataaaaat
tttcttttagtttttgttacttatcttgccaatacccttatctcatattggtttaagaat
tacgaacaagctgtaaccaatgctatgcaagcgacgcaatacgccttcgcagcaagtggt
tttatacatattacagaacacaatttttactactctttagcattacttggtgcatatcct
gatgtagaaaacagtttgcaacagcagtatatgcaacaagtggaaaacaatcagcaagct
atgcaactttgggcagagaacgccccggctaattatcaacataaatatgatttaattaat
gcagaaaaagcacgaattttgggtaatattggcgaagcaatggaatattacgatcgcgct
attaaagcagccaaaaagcagcaatatactcaagaagaaggtttagccaatgagttagca
gcggagttttatttttcacgaggcaaagataaagttgctactacatatctcactgatgct
tactactgttatatccactgggaagccacagcaaaagtcaaagatttagaattaagatat
cctcaaatattttcccagatacttgctagaaaaaactttagtatagatttagataaaaca
acgtccttaaccactgctgtcggtacatttgctttagatttaacgacagtaatgaaagcg
tcacaaaccctgagtcgagaaatacttctcaatgatttaattgagaaactgatgaaaatt
gtgatggaaaatgctggcgctcaaaatagttgcttaattttagataagaaaggtaagcta
gtcgtagaagcaacggtatttgtagataaaaatgaccttgttttatttccctctataccc
cttgaggatagtgaaacattgccgctatctttaattaactatgtggcgagaacacaagaa
aatgtagttcttagagatgctggcagggaaggtaattttattacagatgcttacattgtc
aaagcaaaacttaagtccattttgtgcgtacctatcattaatcaaggtacggttattggt
attctttacttagaaaataatttgactgctggggcgtttaccccagaaaggttagaggtt
ttaaggattctttctacccaagctgctatctcccttaaaaatgcgatgctgtatgccaac
ttggaaacagctacagaagaattgaaagtagctaacactaagttagaggagtacagccgc
accttggagcaaaaggtggaaacaagaaccctggaattaaaagataagaatttacgtttg
gaacaaacactaacagaattgcagcaaacacagactcaacttattcaaactgagaagatg
tcgagtttggggcagttagttgctggaattgcacatgaaattaataatcctgttaatttc
attcatggcaatatacttcatgctagtgaatatattgatggtttgttgaatttagttaat
ctttatcaagagcaatacccaaatagcacgcctaaaattcaagacgagatagaagcaatt
gatctagaatttctccgtgaagatttaccaaaagtgattgaatctatgcaaataggttca
gagcgtatccgccagattgtgctctcacttcgcaacttttctcgtttagatgaagcggag
atgaaaaaagttgatattcacgaaggaattgatagcaccttactgattttgcagcatcgc
ttaaaagccaaatcagaacatagcgaaattaaaattattaaagaatacggcgatttacca
aaagttgaatgttaccctgggcagctaaatcaagtatttatgaatattgtaagtaatgca
attgatgtcttagaagaatatgactctaaacgttcaggattggaaagacagcaaaacccc
tgtactattcgcattcatacacatttgatagatggtaataaagtaaagattagtatagct
gacaatggttctgggatgagggaagaagtacgctcaaaaatatttgacccatttttcaca
accaaatctgtaggttctggtactggtctgggattatctattagctatcaaattgtggtt
gaaaaacaccgtggtcatttggagtgtatttcctcacctggtaaaggagcagagtttatt
attactattcctacttcatag

DBGET integrated database retrieval system