KEGG   Crinalium epipsammum: Cri9333_3681Help
Entry
Cri9333_3681      CDS       T02373                                 

Definition
(GenBank) nitrate ABC transporter, inner membrane subunit
  KO
K15577  nitrate/nitrite transport system permease protein
Organism
cep  Crinalium epipsammum
Pathway
cep00910  Nitrogen metabolism
cep02010  ABC transporters
Module
cep_M00438  Nitrate/nitrite transport system
cep_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:cep00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    Cri9333_3681
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Cri9333_3681
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cep02000]
    Cri9333_3681
Transporters [BR:cep02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    Cri9333_3681
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AFZ14494
UniProt: K9W3W9
LinkDB All DBs
Position
complement(4128998..4129837)
Genome map
AA seq 279 aa AA seqDB search
MTGQTARRQSNRLPNMARSWFKKQTKELVPPLIAIAVFLVIWQILCPPGSKGLPGPLQVL
TDTWYPYIIFPFFNNGGTDKGLGWQIFASLQRVAIGFSLATFVGIGLGIWVGTNKVIYRA
LDPMFQVFRTIPPLAWLPISLAAFQQSNPSAIFVIFITAIWPIIINTTVGVQQIPQDYRN
VSRVLRLSNRKYFLKILIPAAVPYIFTGLRIGIGLSWLAIVAAEMLVGGVGIGFFIWDAY
NNSLLSQIILALLYVGIVGLILDRMVAFLASLVVPEEQK
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgactggacaaactgctcgtcgtcaaagcaacagactaccaaatatggcgagatcttgg
tttaaaaaacaaaccaaagaacttgtgccaccattgattgcgatcgcagtttttttggta
atctggcaaatactttgtcccccaggctcaaaaggtttaccagggccattacaagtatta
actgatacgtggtatccctatattatctttcctttctttaacaacggtggtacagacaaa
ggcttaggttggcaaatctttgctagtttacaacgagtagctattggtttttctttagct
acctttgtgggaattggtttagggatttgggtgggaactaataaagttatatatcgtgct
ttagatcccatgttccaagtatttaggactattccccctttagcatggctaccaatttca
ttagcagcctttcaacaaagtaatccctcagctattttcgtaatttttattaccgcaatt
tggccaattattattaacaccacagttggcgtacaacagattccccaagactacaggaat
gtttccagagttttacgtctgtccaatcggaagtattttctcaaaattttgattccagca
gcagttccctacatttttacaggtttaagaattggcataggtttatcttggttagcaatt
gtggcggctgaaatgctagtaggtggtgtagggattggtttctttatctgggacgcttac
aacaactccttactcagccaaattattctagcgttgctgtatgtcggtattgttggtttg
atactagacagaatggtagcttttctcgcctctctagttgtaccagaagaacaaaagtaa

DBGET integrated database retrieval system