KEGG   Crinalium epipsammum: Cri9333_4025Help
Entry
Cri9333_4025      CDS       T02373                                 

Definition
(GenBank) Maltose alpha-D-glucosyltransferase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
cep  Crinalium epipsammum
Pathway
cep00500  Starch and sucrose metabolism
cep01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Cri9333_4025
Enzymes [BR:cep01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Cri9333_4025
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     Cri9333_4025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C
Motif
Other DBs
NCBI-ProteinID: AFZ14830
UniProt: K9W5S5
LinkDB All DBs
Position
complement(4551045..4552682)
Genome map
AA seq 545 aa AA seqDB search
MLDLWYKNAVIYCIDVETYMDANGDGIGDFIGLTQKLDYLAGLGVTCIWLMPFYPSPNKD
NGYDVMDYYNVDSRLGTLGDFVEFTVQARERGMRILVDLVVNHTSSQHPWFQAACKNKNS
KYWNYYLWSKQKPKDIKEGIVFPGFQKTTWTYHPEAEAYYAHRFYDHQADLNITNPEVRA
EIQKIMGFWLALGVSGFRIDAAPFLIELQQADNICEMVDDPIVYIEEFRKFLSWRQGNAI
LLAEVNELPEEQSRYFGNGNRMQMLFNFWANQHLILALVQEKAAPLIEALARLPEIPEVG
QWANFIRNHDELTLDKLSEAQQEEIAAALAPDQEKMWIFDRGIRRRFAPMINGDPRRLKL
TYSLLLTLPGTPVINYGEELGMGDDLSLPERHPARTPMQWSSEPNGGFSTAPSDKLVLPV
IDEGEYGYKHLNVSVQRRDPESLLNWMERAIRMRKECPAFGWGKWQILETGHESVFAHRC
EWNGEVAIAIHNLSSEPSHISLTLTDDKGSYLVDLFEDQPDEEVLKISQDIQLAAYGYRW
FRVRR
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgttggatttatggtacaaaaatgctgtgatctactgcatcgatgtcgaaacatacatg
gatgcaaatggtgatggtattggtgattttataggactaacccaaaaattagactatctt
gcgggcttgggagttacctgcatttggctaatgccattctatccttctcctaataaggat
aacggctacgacgtgatggattattacaacgtcgattctcgcttgggaacgctaggcgat
tttgtagaatttaccgttcaagcgcgtgagcgtggtatgcgaatattggttgacttagta
gttaaccacacatcctcgcaacatccctggtttcaagcagcctgcaaaaacaaaaactca
aaatactggaactactatctgtggtcgaaacagaaacccaaggatatcaaggaaggaatt
gtctttcctggcttccaaaaaactacttggacatatcacccagaagcagaagcgtattat
gctcataggttttacgatcatcaagcagacttaaatattactaatcctgaagttagggca
gaaattcaaaaaattatgggtttctggttagctttaggcgtatctgggtttcggattgat
gctgcaccatttttgattgaattgcagcaagctgacaatatctgtgaaatggtagacgat
ccgattgtctatattgaagagtttcgtaaatttctttcctggcggcagggtaatgccatt
ttgttagcagaagtgaatgaacttcctgaagaacaaagccgatattttgggaatggtaat
aggatgcagatgctgttcaatttttgggcaaatcagcatctaattctggctcttgttcag
gaaaaagctgcaccactgattgaggcattagcaagattacccgaaattcccgaagttggt
cagtgggcaaattttatccgtaaccatgatgagttaacactagataaactttctgaggct
caacaagaggaaatcgccgccgcgctagcaccagatcaagaaaaaatgtggatttttgat
cgcggtatccgccgccgcttcgctcctatgattaacggcgatccacgacgactcaagctt
acttatagtttactgctaactttaccaggtactcctgtaattaattacggtgaggaactg
ggtatgggtgatgatttatctttaccagagcgtcatccggctcgtactcccatgcagtgg
tcgagcgaacccaatggtggtttctcaactgctccctccgataagttagtgctgccagtt
attgatgaaggggaatacggttacaagcacttaaatgttagtgtacaacgccgcgatcca
gaatcgctgcttaactggatggagcgggcaatccgtatgcggaaggaatgcccagcattt
ggttgggggaaatggcaaattttggaaacagggcatgaaagcgtgtttgcccaccgttgt
gagtggaatggtgaagtggcgatcgctattcacaatctatcttctgagccaagtcatata
tcattaacgctcacagatgacaagggcagctatttggttgacttatttgaagaccaaccc
gatgaagaggttttaaagatttcacaagatatccaacttgcggcttatggctatcgttgg
tttcgagtcagacgctag

DBGET integrated database retrieval system