KEGG   Crinalium epipsammum: Cri9333_4684Help
Entry
Cri9333_4684      CDS       T02373                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
cep  Crinalium epipsammum
Brite
Enzymes [BR:cep01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Cri9333_4684
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu Big_3_5 DUF4884 CHRD
Motif
Other DBs
NCBI-ProteinID: AFZ15463
UniProt: K9W528
LinkDB All DBs
Position
complement(5290408..5290983)
Genome map
AA seq 191 aa AA seqDB search
MPKFIMSAMLLVILTSCTEGNRPQTEVSPAATPITKSSAQEAQQKAVATLQPTAGNKAAG
TIAFTQAGDSTSIKVDVTGLAPGKHGFHVHEKGDCSSKDAKSAGDHFNPTKQPHAAPTAA
KRHVGDLGNLTADSTGKATTQLQDSALRLSGEQSIIGRAVIIHAKADDLKSQPSGDAGGR
LACGVIKATNS
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaatttattatgtctgcaatgcttttagttatcttaactagctgtacggaagga
aaccgtccacagacagaagtttctcccgcagcaacgcccattactaaatcctctgctcag
gaagcacaacaaaaagcagtggcaacgctgcaacctacagcaggtaataaggctgctggc
actatagcctttacacaagcaggagattcaacttcaattaaggtggatgtaacaggtttg
gctcctggtaaacacggttttcatgtccatgaaaaaggcgattgcagtagcaaagatgct
aaatcggcaggagaccattttaacccgaccaaacagcctcacgctgcgccgacagcagca
aaacgccatgtgggagatttaggaaacttaacggctgatagtacaggtaaggcaacaaca
caactgcaagattcggcgcttcgtctatcaggtgagcagtctattattggtcgcgcggtg
attattcacgctaaagccgatgaccttaagagtcaaccatctggtgatgcaggtggacgg
ctggcttgcggtgtgattaaagctacaaactcttga

DBGET integrated database retrieval system