KEGG   Cyanobacterium endosymbiont of Rhopalodia gibberula: RGRSB_0350Help
Entry
RGRSB_0350        CDS       T05747                                 

Gene name
gatB
Definition
(GenBank) aspartyl/glutamyl-tRNA amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
cer  Cyanobacterium endosymbiont of Rhopalodia gibberula
Pathway
cer00970  Aminoacyl-tRNA biosynthesis
cer01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cer00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    RGRSB_0350 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:cer03029]
    RGRSB_0350 (gatB)
Enzymes [BR:cer01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     RGRSB_0350 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     RGRSB_0350 (gatB)
Mitochondrial biogenesis [BR:cer03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    RGRSB_0350 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey ScsC_N ComX
Motif
Other DBs
NCBI-ProteinID: BBA78944
UniProt: A0A2Z5T6I4
LinkDB All DBs
Position
568016..569503
Genome map
AA seq 495 aa AA seqDB search
MTTATPFQTKYEAVIGLETHCQLNTSSKIFCACSTKFDSPPNTNICPICLGYPGVLPVLN
KEVLASAGRLGLAIDGKIALYSKFDRKQYFYADLPKNYQISQYDFPIVEHGFLEIELVDK
KNKEVTRKIIGITRLHMEEDAGKLVHAGSDSLSGSTHSLVDFNRTGVPLLEIVSEPDLRS
GREAAEYAQELRRLVRYLGISDGNMQEGSLRCDVNISVRPVGQKEFGTKIEIKNMNSFNA
IQKAIEYEIKRQIETLERGESLFQETRLWEEKSQCTVSMRKKEGASDYRYFPEPDIPPLE
ISPDQLENWRKTIPELPAKKRKRYEKELGISAYDARVLTDDRDIANFYEKAVETGADAKL
VANWVTQDIAAYLNNSKLDITKISLDPVNLGELVQLIEKGTISGKIAKEILPELLEKGGS
PEKLVEAKGMTQISDTKEIEKIVDEVLLSNPNELEKFRNGKTKLKGFFVGQVIKKTGGRA
DPKLTNQLVEKKLKG
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgactactgcaaccccttttcaaactaaatacgaagccgttattgggttagaaacccat
tgtcaacttaacactagtagtaaaattttctgcgcctgttcaactaagtttgacagtcct
cccaacactaatatatgtccaatttgtttgggctatccgggggttttacctgtcctcaac
aaagaagttttagcctctgcaggtaggttaggactggcaatcgatggaaaaatcgcttta
tatagtaagtttgaccgcaaacaatatttctatgctgatcttcctaagaattaccagatt
tctcaatacgatttccccatcgtcgaacacggtttcctcgaaattgaattggtggataaa
aaaaacaaggaagttacccgtaaaatcattggtataactcgtttacacatggaagaagat
gccggaaaattagttcatgcaggaagtgattccctatcaggatcaactcactccctagta
gattttaatcggacaggcgttcctctactcgaaattgtttcagaacctgacttgcgctca
ggacgagaggcagcagaatacgcccaagagttacgtcgtttagtccgttatttaggtatt
agtgatggtaatatgcaagagggatcattgcgctgtgatgttaatatttctgtccgtcct
gtgggacaaaaagagtttggaaccaagatagaaattaaaaatatgaactcttttaatgcc
atccaaaaagctattgaatacgaaattaaacggcaaattgagaccttagaaaggggtgaa
tctctattccaagaaactcgtctttgggaagagaaaagtcagtgcaccgttagtatgagg
aaaaaggaaggagctagtgactatcgttactttcctgaacctgatattcctcctttagag
atatctcccgaccaattagaaaattggcggaaaactattccagaacttcctgcaaaaaag
cggaaacgttatgagaaagaattaggaatttctgcttatgatgcccgcgttttaaccgat
gatcgagatatagctaatttttatgaaaaagctgtagagactggggctgatgctaagtta
gtagctaattgggtcactcaagatattgctgcctatttaaataatagtaagttagacata
accaaaatttctttggacccagttaatttaggggagttagtccaactcattgagaaggga
accattagtggcaaaattgccaaagaaatccttccagaactattagaaaaaggtggatca
ccagaaaagttggttgaagctaaaggaatgacccaaatttcggatacaaaagaaattgaa
aaaatagttgatgaagtattgctttctaaccctaacgaacttgaaaaattccgcaatgga
aaaactaagctaaaaggtttttttgtcggtcaagtaataaagaagacaggtggacgagcc
gatcctaaactgacaaatcagttagtagagaaaaaactgaaaggctaa

DBGET integrated database retrieval system