KEGG   Cyanobacterium endosymbiont of Rhopalodia gibberula: RGRSB_0429Help
Entry
RGRSB_0429        CDS       T05747                                 

Gene name
pdhC
Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cer  Cyanobacterium endosymbiont of Rhopalodia gibberula
Pathway
cer00010  Glycolysis / Gluconeogenesis
cer00020  Citrate cycle (TCA cycle)
cer00620  Pyruvate metabolism
cer01100  Metabolic pathways
cer01110  Biosynthesis of secondary metabolites
cer01120  Microbial metabolism in diverse environments
cer01130  Biosynthesis of antibiotics
cer01200  Carbon metabolism
Module
cer_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cer00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RGRSB_0429 (pdhC)
   00020 Citrate cycle (TCA cycle)
    RGRSB_0429 (pdhC)
   00620 Pyruvate metabolism
    RGRSB_0429 (pdhC)
Enzymes [BR:cer01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     RGRSB_0429 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 AATase
Motif
Other DBs
NCBI-ProteinID: BBA79011
UniProt: A0A2Z5SX98
LinkDB All DBs
Position
692752..694038
Genome map
AA seq 428 aa AA seqDB search
MPALSSTMTEGKIISWAKSPGDKVEKGETVVVVESDKADMDVESFYEGYLATILVKAGQE
APVGEAIALLADTKAEIAQAQQKASSSSVQTLQETPQTVVSISTPEATKTPTTAFSTSTD
TSKTNGNRGTNDRIIASPRAKKLAKQLGIELKTLQGSGPYGRIVAEDVERTTRRTPTATI
TQTLFSASQPTPTPSTSPTPVPIISGEAVPLTVLQKAVVQNMMATVQVPTYHVGYTITTD
NLDKLYKTIKSKGVTMTALLAKAVAVTLQKHPLVNASYSDQGIHYNSSVNVALAVAMPDG
GLITPVLQNADQIDIYSLSRTWKDLVERARKKQLQPQEYKNGTITISNLGMFGVDCFDAI
LPPGQGAILAIGKSRPQVVATSEGLTGVKCQMTVNITCDHRVIYGAHAAAFLQDLAQLIE
TDVQFLTM
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcactcagttccaccatgacagagggaaaaatcatctcttgggcgaagtctccg
ggggataaagtggaaaaaggagaaactgttgttgtagttgaatcagataaagcagatatg
gacgtggaatctttctatgagggttatctagccaccattttggtaaaagctggacaagaa
gcccctgtaggagaagcgattgccctcttggcagataccaaagcagaaattgctcaagcg
cagcaaaaagcttcctcaagctcagtgcaaactcttcaagaaactccccaaactgtagtc
tcaatctccacccctgaagcaactaagacaccaacaacagctttttctacttcgacagat
acttctaaaaccaatggaaatcgtggcactaatgaccgcatcattgcttcaccacgggcg
aagaaactagctaaacaattaggcattgagctcaaaacccttcagggcagtggaccttat
ggacgcattgttgctgaagatgtagaacgcactacaagaagaactccaactgcaactatt
acccagactttattttctgcatctcaaccgactccaactccaagtacgtcgccaactcct
gtacctattatctcaggagaagccgttccccttaccgtcctgcaaaaagcagtagtacaa
aatatgatggcgacggtgcaagttcctacctatcatgtgggttatacgataactaccgac
aatttagataaactctataagacaattaaatctaaaggggtaactatgacggctttatta
gcaaaagcagtggctgttacccttcaaaaacatcctttagttaacgctagttacagtgac
caaggaattcactataatagctcagttaacgttgctttagcagtagcaatgcctgatggg
ggacttattactcctgttctacagaatgcagatcaaatcgatatttattctctgtctcgt
acgtggaaagacttagtagaacgcgctaggaagaaacaattgcaaccacaagaatataaa
aacggaactattaccatatcaaatttaggaatgtttggggtagactgtttcgatgcaatt
ttacctccaggacagggagcaattttagctattggtaaatctcgtccccaagtagtagca
acctcagaaggattgactggagtaaaatgtcagatgacagtaaatatcacttgcgatcat
cgggtaatttatggggctcatgcagctgcatttttgcaagatttagctcagttaatcgaa
accgatgttcaattcttaacaatgtga

DBGET integrated database retrieval system