KEGG   Cellulosimicrobium sp. TH-20: B8281_00515Help
Entry
B8281_00515       CDS       T04804                                 

Definition
(GenBank) 2,3-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
cet  Cellulosimicrobium sp. TH-20
Pathway
cet00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:cet00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    B8281_00515
Enzymes [BR:cet01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     B8281_00515
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     B8281_00515
    1.1.1.-  
     B8281_00515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_assoc AdoHcyase_NAD
Motif
Other DBs
NCBI-ProteinID: ARK06524
UniProt: A0A1W6DUF3
LinkDB All DBs
Position
115086..116144
Genome map
AA seq 352 aa AA seqDB search
MKAARYHGKEDLRIEDVPEPETRPGTVKIRPAWTGICGSDLHLYLEGPFPPAPSETQPHP
LSGETLPVVFGHEFSGVVEELGEGVEGLAVGDAVVVEPFMVCGECPPCRDGLYNACVKMG
FIGISGRGGGLAEHVVVERRWVHPVGDVPLDQVALIEPLAVAYHGARLSGAQAGDTVLVG
GAGPIGLLTCAVLHAIGARAIVTEVSGARKAKALETGVADDVLDPREVDVAARVLELTDG
RGADVAIECSGAQPVLDTLTRALKAGGTLQIVALFSEPPTLDVMTVLLRELTIKGAIGYA
DDHPAVIRLVQEGKVDLAPFVTSRIAVEDVVEKGYRELIDHKDDHVKIVVSV
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcggcgcggtaccacggcaaggaagacctccggatcgaggacgtcccggagccc
gagacccggccggggaccgtgaagatccggcccgcgtggacggggatctgcggctcggac
ctgcacctctacctcgagggcccgttcccgccggcgccgtcggagacgcagccgcacccc
ctgtcgggcgagacgctgcccgtcgtgttcgggcacgagttctccggcgtggtcgaggag
ctcggcgagggcgtcgagggcctcgcggtcggggacgcggtcgtcgtcgagccgttcatg
gtgtgcggcgagtgcccgccgtgccgcgacggcctctacaacgcgtgcgtgaagatgggc
ttcatcggcatctccggccggggcggcgggctggcggagcacgtcgtggtcgagcggcgg
tgggtgcacccggtgggcgacgtcccgctggaccaggtggcgctcatcgagccgctggcc
gtcgcgtaccacggcgcccgcctgtcgggcgcgcaggcgggcgacacggtcctcgtcggc
ggcgcgggcccgatcggcctgctcacgtgcgccgtgctgcacgcgatcggggcgcgcgcg
atcgtcacggaggtgagcggggcgcgcaaggccaaggcgctggagaccggggtggccgac
gacgtcctcgacccgcgcgaggtcgacgtcgccgcgcgcgtcctcgagctcacggacggc
cgcggcgcggacgtcgcgatcgagtgctcgggcgcgcaacctgtgctcgacacgctgacc
cgcgcgctcaaggcgggcggcacgctccagatcgtggcgctgttctccgagccgccgacg
ctcgacgtcatgacggtcctgctccgcgagctgaccatcaagggcgcgatcgggtacgcg
gacgaccacccggccgtgatccggctcgtgcaggagggcaaggtcgacctcgccccgttc
gtgacgagccgcatcgccgtcgaggacgtcgtggagaaggggtaccgagagctcatcgac
cacaaggacgatcacgtgaagatcgtcgtgtcggtgtga

DBGET integrated database retrieval system