KEGG   Cellulosimicrobium sp. TH-20: B8281_02605Help
Entry
B8281_02605       CDS       T04804                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
cet  Cellulosimicrobium sp. TH-20
Pathway
cet00250  Alanine, aspartate and glutamate metabolism
cet00410  beta-Alanine metabolism
cet00430  Taurine and hypotaurine metabolism
cet00650  Butanoate metabolism
cet01100  Metabolic pathways
cet01110  Biosynthesis of secondary metabolites
cet01120  Microbial metabolism in diverse environments
cet02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:cet00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    B8281_02605
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    B8281_02605
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    B8281_02605
   00430 Taurine and hypotaurine metabolism
    B8281_02605
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    B8281_02605
Enzymes [BR:cet01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     B8281_02605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ARK03787
UniProt: A0A1W6DM24
LinkDB All DBs
Position
complement(590363..591769)
Genome map
AA seq 468 aa AA seqDB search
MVTNTRRAERHTGEPDVVELNPIFARPGEATALPKFRFPEDESLQETAYQIVHDEAMLDG
NARLNLATFVGTWMDEHAARLYLEAADKNMIDKDEYPQTAAVETRCWTMLADLWHAPDPE
HTIGTSTIGSSEACMLGGLALKRRWQHARRAAGKPTDRPNLVLSSAVQVCWEKFCNYFEV
EARYVPISEDHKVLDGHDLETYVDENTIGVVAIMGVTYTGMYEPVAEIAAALDRIQESTG
LDVPIHVDGASGAMIAPFLQPDLEWDFRVPRVASINTSGHKYGLVYPGLGWVVWRDTESL
PEDLVFRVSYLGGDMPTFALNFSRPGAQVLLQYYLFLRLGRTGYEAVQRTSRDVALYLSG
EIAKMPAFELWNDGSDIPVFAWRLREGHTKNWDLYHLSERLRTKGWLVPAYPMPDDLTDL
TVQRVVVRNGFSHDLASAFLADLRDEVELLDALTGPMPTEGQRSNFHH
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggtcacgaacacgcgccgggccgagaggcacaccggagaacccgacgtcgtcgagctc
aacccgatcttcgccagaccgggggaggcgacggccctgcccaagttccggttcccggag
gacgagtccctccaggagacggcgtaccagatcgtccacgacgaggcgatgctcgacggg
aacgcgcggctcaacctcgcgacgttcgtcggcacgtggatggacgagcacgctgcgcgg
ctgtacctcgaggccgccgacaagaacatgatcgacaaggacgagtacccgcagacggcg
gccgtcgagacgcggtgctggacgatgctcgccgacctgtggcacgcgcccgacccggag
cacaccatcgggacgtcgaccatcggctcgtccgaggcgtgcatgctcggcggtctcgcc
ctcaagcggcgctggcagcacgcgcgccgcgccgccggcaagccgaccgaccgcccgaac
ctcgtgctctcgagcgcggtccaggtgtgctgggagaagttctgcaactacttcgaggtc
gaggcgcgctacgtcccgatctccgaggaccacaaggtcctcgacggccacgacctcgag
acgtacgtggacgagaacacgatcggcgtcgtcgccatcatgggcgtgacctacaccggc
atgtacgagccggtcgccgagatcgccgcggccctcgaccggatccaggagtccaccggc
ctggacgtgcccatccacgtcgacggcgcgtcgggcgcgatgatcgccccgttcctccag
cccgacctcgagtgggacttccgcgtcccccgcgtcgcgtcgatcaacacctccggccac
aagtacggcctggtctacccgggcctcgggtgggtcgtctggcgcgacacggagtcgctg
ccggaggacctcgtgttccgcgtgagctacctcggcggggacatgccgacgttcgccctc
aacttctcgcgccccggcgcgcaggtgctcctccagtactacctcttcctgcgcctcggg
cgcaccggctacgaggccgtgcagcgcacgtcgcgcgacgtcgcgctctacctgtcgggc
gagatcgcgaagatgcccgcgttcgagctgtggaacgacggctcggacatccccgtgttc
gcgtggcgcctgcgcgagggccacacgaagaactgggacctctaccacctgtcggagcgg
ctgcgcaccaagggctggctcgtgcccgcgtaccccatgcccgacgacctcacggacctc
accgtccagcgcgtcgtcgtgcgcaacggcttcagccacgacctggcgtccgcgttcctc
gcggacctgcgcgacgaggtcgagctcctcgacgctctcaccggcccgatgccgaccgag
ggccagcgctccaacttccaccactga

DBGET integrated database retrieval system