KEGG   Cellulosimicrobium sp. TH-20: B8281_13585Help
Entry
B8281_13585       CDS       T04804                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
cet  Cellulosimicrobium sp. TH-20
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C FANC_SAP RNA_ligase
Motif
Other DBs
NCBI-ProteinID: ARK05614
UniProt: A0A1W6DRQ0
LinkDB All DBs
Position
complement(3065831..3066937)
Genome map
AA seq 368 aa AA seqDB search
MDLPVMPPVLPMLAKSVPAVPEPDAVDGGYVYEPKWDGFRAIVYRDGDEVRLDSRNARPM
DRYFPEVVEAVRAALQPQCVVDGEIVVARDGRLEFEVLQQRIHPAASRVRLLAEQTPAAL
VVFDVLALGDEDLTRAPLARRQEVLDSLGLDGPAVHATPRTRDVAVAREWFDTFEGAGLD
GVVAKPLDGTYQPNKRAMLKIKHGREADVVLAGYRLHKTSTPAKPLLGSLLLGLYDDAGQ
LQFVGVAASFPTARRAALVEELAPLVVEPGTPDADAHPWSGWENPAGERRPGAVSRWSSG
KDLSFTPLRPERVLEVAYDHMEGSRFRHTAQFRRWRDDRDPESCTYEQLEEPVRYDLTGI
LPGAPGVD
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggacctgcccgtcatgccccccgtgctgcccatgctcgcgaagtccgtgcccgccgtg
cccgagcccgacgccgtcgacggcgggtacgtgtacgagccgaagtgggacggcttccgc
gcgatcgtgtaccgcgacggcgacgaggtgcggctcgacagcaggaacgcgcgtcccatg
gaccgctacttccccgaggtcgtcgaggcggtgcgggctgctctgcagccccagtgcgtg
gtcgacggtgagatcgtcgtcgcgcgggacggtcgcctcgagttcgaggtcctccagcag
cgcatccacccggcggcgtcgcgcgtgcgcctgctcgcggagcagacccccgcagccctc
gtcgtgttcgacgtgctcgcgctgggggacgaggacctcacgcgcgcgccgctcgcgcgg
cggcaggaggtcctcgactccctgggcctcgacggcccggccgtgcacgccacgccccgc
acgcgcgacgtcgccgtggcgcgggagtggttcgacacgttcgagggggcgggcctggac
ggcgtcgtcgccaagccgctcgacggcacgtaccagccgaacaagcgcgcgatgctcaag
atcaagcacggccgcgaggcggacgtcgtcctcgcggggtaccgcctgcacaagacgtcg
acccccgcgaagccgctgctcggctcgctcctgctcggcctgtacgacgacgcgggccag
ctccagttcgtcggcgtcgccgcgtcgttcccgacggcgcggcgcgccgcgctggtcgag
gagctcgcgccgctcgtcgtcgagccgggcacgccggacgcggacgcgcacccgtggtcc
gggtgggagaacccggccggcgagcggaggccgggtgcggtgtcgcgctggagctcgggc
aaggacctgtcgttcacgccgctgcgcccggagcgcgtgctcgaggtcgcctacgaccac
atggagggctcccggttccggcacaccgcgcagttccggcgctggcgcgacgatcgcgac
ccggagtcgtgcacctacgagcagctcgaggagccggtgcgctacgacctcacgggcatc
ctgcccggggcgcccggcgtcgactga

DBGET integrated database retrieval system