KEGG   Cellulosimicrobium sp. TH-20: B8281_17120Help
Entry
B8281_17120       CDS       T04804                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
cet  Cellulosimicrobium sp. TH-20
Pathway
cet00020  Citrate cycle (TCA cycle)
cet00480  Glutathione metabolism
cet01100  Metabolic pathways
cet01110  Biosynthesis of secondary metabolites
cet01120  Microbial metabolism in diverse environments
cet01130  Biosynthesis of antibiotics
cet01200  Carbon metabolism
cet01210  2-Oxocarboxylic acid metabolism
cet01230  Biosynthesis of amino acids
Module
cet_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cet_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:cet00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    B8281_17120
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    B8281_17120
Enzymes [BR:cet01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     B8281_17120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ARK06192
UniProt: A0A1W6DT94
LinkDB All DBs
Position
complement(3840735..3841952)
Genome map
AA seq 405 aa AA seqDB search
MGKIKVVNPVVELDGDEMTRIIWQFIKDRLIHPYLDVDLKYYDLSIQNRDATDDQVTIDA
AHAIKQYNVGVKCATITPDEARVEEFGLKKMWVSPNGTIRNILGGVVFREPIIISNIPRL
VPGWNKPIIIGRHAHGDQYKSTNFKVPGPGKITMTFEPADGSEAQKFEVVTMPEEGGVAM
GMYNFNESIRDFARASFAYGLQREYPVYLSTKNTILKAYDGAFKDIFQEVFDAEFAEAFA
AKGITYEHRLIDDMVASAMKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLMTPDG
QTVEAEAAHGTVTRHYRQHQQGKPTSTNPIASIFAWTRGLMHRGKLDGTPEVTEFAQTLE
DVVIKTVESGKMTKDLALLIGPDQEWLTTEEFLAALDENLKARLG
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagatcaaggtcgtcaacccggtcgtcgagctcgacggcgacgagatgacgcgc
atcatctggcagttcatcaaggaccgcctcatccacccgtacctcgacgtggacctcaag
tactacgacctgtcgatccagaaccgcgacgcgaccgacgaccaggtcacgatcgacgcc
gcgcacgcgatcaagcagtacaacgtcggcgtcaagtgcgcgacgatcacgcccgacgag
gcgcgcgtcgaggagttcggcctgaagaagatgtgggtctcgccgaacggcacgatccgc
aacatcctcggtggcgtcgtcttccgcgagccgatcatcatctccaacatcccgcgcctc
gtgccgggctggaacaagccgatcatcatcggccgtcacgcccacggcgaccagtacaag
tcgacgaacttcaaggtccccggcccgggcaagatcacgatgacgttcgagccggccgac
ggctccgaggcgcagaagttcgaggtcgtgaccatgccggaggagggcggcgtcgcgatg
ggcatgtacaacttcaacgagtcgatccgcgacttcgcgcgcgcctcgttcgcgtacggc
ctccagcgcgagtaccccgtgtacctctcgaccaagaacacgatcctcaaggcctacgac
ggcgccttcaaggacatcttccaggaggtgttcgacgccgagttcgccgaggcgttcgcc
gccaagggcatcacctacgagcaccgcctcatcgacgacatggtcgcctctgccatgaag
tgggagggcggctacgtctgggcctgcaagaactacgacggcgacgtccagtccgacacc
gtcgcgcagggcttcggctcgctcggcctcatgacgtcggtcctcatgaccccggacggc
cagaccgtcgaggccgaggccgcgcacggcacggtgacgcgccactaccgccagcaccag
cagggcaagccgacgtcgacgaacccgatcgcgtcgatcttcgcctggacgcgtggcctc
atgcaccgcggcaagctcgacggcacgcccgaggtcaccgagttcgcgcagacgctcgag
gacgtcgtcatcaagacggtcgagtccggcaagatgacgaaggacctcgcgctcctcatc
ggtccggaccaggagtggctgacgacggaggagttcctcgccgcgctggacgagaacctc
aaggcgcgcctgggctga

DBGET integrated database retrieval system