KEGG   Clostridium estertheticum: A7L45_02350
Entry
A7L45_02350       CDS       T04811                                 

Definition
(GenBank) sucrose phosphorylase
  KO
K21350  sucrose 6(F)-phosphate phosphorylase [EC:2.4.1.329]
Organism
ceu  Clostridium estertheticum
Brite
KEGG Orthology (KO) [BR:ceu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    A7L45_02350
Enzymes [BR:ceu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.329  sucrose 6F-phosphate phosphorylase
     A7L45_02350
SSDB
Motif
Pfam: Alpha-amylase Pro_sub2
Other DBs
NCBI-ProteinID: APC38986
UniProt: A0A1J0GCA9
LinkDB
Position
490245..491714
AA seq 489 aa
MAVKNQVQLITYPDSMGGNLKILNNVLLKHFSDIFKGGVHILPPFPSSGDRGFAPLTYLM
IEPEFGTWEDIKAIGENFDILVDLMVNHISGESVYFQDFLKQGRNSEYADLFITLDKVWE
DGKPVKKDIEKMSLRRKVPYSTFKIKETGEEERVWTSFGKTSPSQQIDLDVKSDKVKQLF
KELFLHFNNHNVKIVRLDAVGYVIKKLGTSCFFVEPEIYDFLNWIKKLADSMKIELLPEV
HSHYSTQYKLAEHGFWIYDFILPYTILDTLINKSSEKLCQYLKERPARQFTMLDCHDGIP
VKPDMDGLIDTKEARKLIDLTLKRGSNLSLILSEEDKSEDGFDVHQIRGSYYSLLECDDD
AYLAARAIQFFAPGIPQVYYVGLLAGENDVENVKKTGEGREINRHNFSLLEIEQSVKKEV
VQRLLKLIRFRNEYPAFNGQFKVLDSSKDVICLYWKKDDSECTLFIDLKTNKSVIEYIDE
SGKLAQYLI
NT seq 1470 nt   +upstreamnt  +downstreamnt
atggcggtaaaaaatcaagtacagcttatcacttatccagattctatgggagggaattta
aaaattcttaacaatgtacttttaaaacatttttctgatatctttaaaggtggagttcat
attctgccaccatttccgtcttcgggagacagagggtttgctccacttacatatttgatg
atagagccagagtttggtacatgggaggatataaaagctataggtgaaaattttgatata
ctggtcgatttaatggttaatcatatttcaggtgagtctgtatattttcaagatttcctt
aagcaaggtagaaattcagagtatgccgatttatttatcactttggacaaggtctgggaa
gacggaaaaccggttaaaaaagacattgaaaagatgtcacttcgcaggaaagtgccatat
tcgacctttaaaataaaagaaaccggtgaggaagaaagggtatggactagttttggcaaa
actagtccttctcagcagattgatttggatgtaaagtcggataaggtaaaacagcttttt
aaagagctatttttgcattttaataatcataacgttaaaatagtaagattagatgcagtt
ggatatgttatcaaaaagcttggaacaagttgtttttttgtagaaccggaaatatatgat
tttcttaattggattaaaaaattggcggattctatgaaaattgaattgcttccagaagtt
cattcacattactctactcaatacaaacttgcagagcatgggttctggatttacgatttt
attctaccttatactattcttgatacattaataaataaatctagtgagaaactttgtcaa
taccttaaggagcgtcctgcgagacaatttacaatgcttgactgccatgatggtattcct
gtaaaacctgatatggatggtctcatagatactaaggaagctagaaaacttatagattta
acccttaagcgaggttcaaatttaagccttattttatcagaagaagataagtcagaagac
ggatttgatgtgcatcaaataagagggtcttactactctttattggagtgtgatgatgat
gcatatttggcagctagggcaattcaattttttgcccctgggataccgcaggtatattat
gtgggactactagcaggagaaaatgatgttgaaaatgtaaagaagaccggtgaaggtcgt
gaaattaaccgtcacaacttcagtcttttggaaattgagcagtcagttaaaaaagaagtt
gttcaaagacttttaaaacttatcagatttagaaatgaatatcctgcatttaatggacaa
tttaaggtcttagactcttccaaagatgttatttgcctttattggaagaaagatgatagt
gaatgcacattatttatcgatttaaaaactaataagtctgtgatagaatatattgatgag
tctggcaagttagctcaatatttaatataa

DBGET integrated database retrieval system