KEGG   Clostridium estertheticum: A7L45_05420Help
Entry
A7L45_05420       CDS       T04811                                 

Definition
(GenBank) hypothetical protein
Organism
ceu  Clostridium estertheticum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like APH
Motif
Other DBs
NCBI-ProteinID: APC39543
UniProt: A0A1J0GE19
LinkDB All DBs
Position
1157733..1158851
Genome map
AA seq 372 aa AA seqDB search
MLNSGDILDGKYEVIRTLGKGGMGVVYLCKNIILGNLWAIKEVIQDKKNIDILTEANILK
NLNHPGIRKIIDTFYSNNNLYMVQDYVDGQTLKEYVKANGIIQIEKICRIVSDLCDIIGY
LHNQNPIIIYRDIKPSNIMIMKSGKVVLIDFGISKVYKNDMSQDIDMICAGSNGYAAPEQ
YGSGKCCMQTDIYGIGMLIYFMVKGRTPYTGIEPLLDENYGPEINNKLKKIIQKCVKIDI
NERYALVEDLKEAISNILPKNEKVKLEILNNSNISKSVITKKVNIKIINKSMYDRSIRIF
FCFTFAIIASIYILYGNKKESTLSNTADAKEIVSPIVGSSSIEQNSIKEFIKKPTRTIRV
VPTKGISSSIAQ
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgttaaatagtggagatatattagacggaaaatatgaggtaattagaaccctaggaaaa
ggtggaatgggtgttgtttatttatgcaaaaacataatacttggaaatctttgggcgata
aaagaagtaatacaagataaaaaaaatatagatattttaacagaagctaatattttaaaa
aatttaaatcatccaggtattcggaaaataattgatacattttattcgaataacaattta
tatatggttcaggactatgtagatggacaaacattaaaggaatatgttaaggcaaacggt
ataatacaaatagaaaaaatttgtaggatagtatcagatttatgtgatattataggctat
ttacataatcaaaatccaatcattatatatagagatataaaaccatctaatataatgata
atgaaaagtggaaaagttgtgttaatagattttggtatttcgaaagtttataagaatgat
atgtcacaggatatagatatgatatgtgcgggatctaatggttatgcagctccagagcaa
tacggttcagggaaatgttgcatgcaaacagatatatatggaattggaatgttaatatac
tttatggtaaaggggaggactccgtatacaggcatagaacctcttttggatgaaaattat
ggaccggaaattaataataaactgaaaaagataatacaaaagtgtgtaaaaattgatatt
aatgagagatatgccttagtagaagacttaaaggaagctatttcaaatatattaccaaag
aatgaaaaagtaaaattagaaatcttaaataattctaatatcagcaaaagtgtaattaca
aaaaaagttaatattaaaattataaataagtctatgtacgataggtctattaggatcttt
ttctgctttacatttgcaattatagcgagtatttatattttgtatgggaataaaaaagaa
agtacactttcgaatactgcagatgcaaaagaaatagttagtcctatagtgggatcatca
agcatagaacaaaattctataaaggaatttataaagaaaccgacaaggacaattagggta
gttccgacaaaaggaatatctagttcaatagctcaatga

DBGET integrated database retrieval system