KEGG   Clostridium estertheticum: A7L45_11460Help
Entry
A7L45_11460       CDS       T04811                                 

Definition
(GenBank) phosphate ABC transporter ATP-binding protein
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
ceu  Clostridium estertheticum
Pathway
ceu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ceu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    A7L45_11460
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ceu02000]
    A7L45_11460
Enzymes [BR:ceu01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     A7L45_11460
Transporters [BR:ceu02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    A7L45_11460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_15 AAA_29 AAA_23 RsgA_GTPase AAA_18 AAA_22 AAA_16 Rad17 ATPase_2 AAA AAA_30 AAA_33 AAA_25 NB-ARC AAA_24 PRK NACHT RNA_helicase Adeno_IVa2 AAA_5
Motif
Other DBs
NCBI-ProteinID: APC40645
UniProt: A0A1J0GH48
LinkDB All DBs
Position
complement(2540218..2540970)
Genome map
AA seq 250 aa AA seqDB search
MGIITAKNLNLYYGNTQALKNVNIDIEKNSVTALIGPSGCGKSTFLRTINRMNDLIDSVK
IDGEILYENENVYGQDYDVIDLRKKVGMVFQKANPFPMSIYENIAYGPRIHGIKNKKLLD
EIVEKSLKGAVLWDEVKDRLKKSALGLSGGQQQRLCIARTLAVEPEVLLMDEPTSALDPI
STLKIEELMDVLKKKYTVIIVTHNMQQAGRISDFTAFFLNGEIVESGKTEEIFYKPKDKR
TEDYITGRFG
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggggataattacagcaaagaatttaaatctatattatggaaatacacaagcgttaaag
aatgtaaatatcgatatagagaaaaattcggttactgcacttataggaccatcagggtgt
ggtaaatcaacatttttacgtactattaatagaatgaatgatttaatagattctgttaaa
atagatggagaaatattatatgaaaatgaaaatgtatacggtcaagactatgatgttata
gatttaaggaaaaaagttggaatggtatttcaaaaggctaacccatttcctatgtcaata
tatgaaaacattgcttatggtcctagaattcatgggataaagaataagaaattgcttgat
gaaattgtagagaaaagtcttaagggggctgtactttgggatgaagtaaaagatagactc
aaaaagagtgcacttggattatccggtggacaacagcagcggctatgcattgcaagaact
ttggctgtagaaccagaggtccttcttatggatgagccaacttctgcattagatcctatt
tcaactttaaaaattgaagagctaatggatgttcttaagaaaaagtatacagttatcatt
gttacacataatatgcaacaagctggtagaatttctgactttacagcatttttcttgaat
ggagaaattgttgaaagtggaaaaacggaagaaatattttataaacctaaagataaaaga
acagaggattatattacaggaagattcggctaa

DBGET integrated database retrieval system