KEGG   Clostridium estertheticum: A7L45_14825Help
Entry
A7L45_14825       CDS       T04811                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ceu  Clostridium estertheticum
Pathway
ceu00473  D-Alanine metabolism
ceu00550  Peptidoglycan biosynthesis
ceu01100  Metabolic pathways
ceu01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ceu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    A7L45_14825
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    A7L45_14825
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    A7L45_14825
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ceu01011]
    A7L45_14825
Enzymes [BR:ceu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     A7L45_14825
Peptidoglycan biosynthesis and degradation proteins [BR:ceu01011]
 Precursor biosynthesis
  Amino acid ligase
   A7L45_14825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp_3 GARS_A ATP-grasp ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: APC41257
UniProt: A0A1J0GIV3
LinkDB All DBs
Position
3215269..3216309
Genome map
AA seq 346 aa AA seqDB search
MKIVVLAGGLSPERDVSLSSGSQIANALREAGHHVVLLDVYEGLRTNESEFESLFEDNIT
GKPYYYNVKGTEPDLNEIKRKSNNGDSLIGKNVLPLCLFADVVFIALHGSMGENGQIQAT
FDSLGIKYTGTGYIGSLLAMDKDLTKKLLHQVGIPTAKWLTFSKNPLTTEYIVKTIGIPC
VVKPCSAGSSIGVSIVHNIEELEVAIATANKIESSLLIEKMIVGREFSVGLLHGKALPVI
EIIPKEGFYDYKNKYQAGLTQDICPANLSEYDTNRIKSLALKICETLRLGTYSRIDFILD
ERDEFICLEANTLPGMTPTSLIPQEALADGISYIELCNIIVNARTK
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcgtggtacttgcaggcggattaagtccagaaagggacgtttcattatcttct
ggaagtcaaattgctaatgctcttagagaagctggtcaccatgtggtgctattagatgta
tatgaaggtttaagaacaaacgaaagcgaatttgaaagtttatttgaagataacattact
gggaagccatattattataatgttaaaggtaccgagcctgatttaaatgaaataaagaga
aaaagcaacaatggggattctcttataggtaaaaatgtattacctctttgcctatttgct
gatgttgtatttatagctctacacggttcaatgggggaaaatggtcaaatacaggcaact
tttgattcactgggaattaaatatactggaactggctatattggtagccttcttgcaatg
gataaggatttaacaaaaaaactgttgcaccaagtaggtattcctacagctaaatggtta
acttttagtaaaaatccactaacaacagaatatatagttaaaacgattggtataccgtgt
gtagtgaaaccttgtagtgccggttcaagtataggggtatcaattgttcataatattgag
gagcttgaagttgcaattgctacagctaataaaattgaatcaagtctacttatcgagaaa
atgatagtaggtagagagttttctgtaggtttattacatgggaaagcattacctgttatt
gaaataataccaaaagaaggattttatgattataagaataaatatcaagcgggattaact
caagatatatgccctgcaaatctttcagaatacgatacaaataggattaagagtctagca
ttaaaaatatgtgaaactttacggcttgggacatattctagaattgattttattttagat
gagagagatgaatttatatgtcttgaagctaatacgcttccaggtatgacacctacaagt
ctaattcctcaagaagctttagctgatggtatttcatatatagaattgtgcaatatcatt
gttaatgctagaacaaaataa

DBGET integrated database retrieval system