KEGG   Clostridium estertheticum: A7L45_20015Help
Entry
A7L45_20015       CDS       T04811                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
ceu  Clostridium estertheticum
Pathway
ceu00473  D-Alanine metabolism
ceu01100  Metabolic pathways
ceu01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ceu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    A7L45_20015
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    A7L45_20015
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ceu01011]
    A7L45_20015
Enzymes [BR:ceu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     A7L45_20015
Peptidoglycan biosynthesis and degradation proteins [BR:ceu01011]
 Precursor biosynthesis
  Racemase
   A7L45_20015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: APC42180
UniProt: A0A1J0GLC0
LinkDB All DBs
Position
complement(4374904..4376064)
Genome map
AA seq 386 aa AA seqDB search
MFKHLRPAWAEVDLDKLAHNMREIRRVTKSKKIMAVVKADAYGHGAVDVAPVLLENGADS
LAVAMLSEAMELRRSGIECPIMILGFTPPELIDNLLKYNIEQTVFSYEFAKQLSKMAQDE
NKIARIHIALDTGMGRIGFLPSDESVQEVYKISLLPNVIIEGIFCHFSTADEKDKTYTNI
QVKKFDEFYQKLEAKKVYINTRHIANSAAIIDLPKIHYEAVRPGIIIYGYYPSDEVNKEK
LDLLPAMTLKTNVVHIKTLPPGECVGYGREYKTDKESVIATLPIGYADGYTRLLFQKAKV
IIKGKFAPVIGKICMDQCMIDITRINGVKVGDEVILIGEDENNKFNADVVGGLIGTISYE
IVCMIGKRVPRVYIKEGEVVKIKEYV
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaacatttaagacctgcatgggctgaggttgatttagataaactagcacataat
atgcgtgagattagacgagtaacgaaaagtaaaaaaattatggcagttgtaaaggcagat
gcttatgggcatggagctgtagatgtagctccagtactacttgaaaatggtgcagatagt
ttagccgttgcaatgttaagtgaagcaatggaactcaggcgatcgggcatagaatgtcca
ataatgatattagggtttacaccaccggaacttatagataatttgttgaagtataatatt
gaacaaactgtattttcatatgaatttgcaaaacaattatcaaagatggcccaagatgaa
aataaaatagcaagaatacacatagctttagacacagggatgggtagaataggtttttta
ccaagtgatgaaagtgtacaagaagtatataagataagtttattacctaacgtaatcata
gaagggattttttgtcacttctcaactgcagatgaaaaagataagacatatactaatatt
caagtgaaaaaatttgatgagttttatcaaaaattagaagcaaaaaaagtttacataaac
acaagacatattgccaatagtgcggctatcatagatttaccaaaaatccattatgaggca
gtacgaccaggaataataatttatggttattatccgtcggatgaggtaaataaggaaaaa
ctagatttattaccggccatgactttaaaaacaaatgttgtacatataaaaacgttgcca
cctggagaatgtgttggttacggaagagaatataaaacagataaagaaagtgttatagca
acacttccaattggttatgctgatgggtatacacggcttttatttcaaaaggcaaaggtt
attataaaaggtaaatttgctccagttatagggaaaatttgtatggatcagtgtatgatt
gatattacaaggatcaatggagtaaaagttggggacgaggttatactaataggcgaagat
gaaaataataaatttaatgcagacgttgtcggtggactaataggtactattagttacgag
atagtttgtatgattggcaaaagagttccgagagtatacattaaggaaggcgaagttgta
aagataaaagagtatgtataa

DBGET integrated database retrieval system