KEGG   Caldisericum exile: CSE_13800Help
Entry
CSE_13800         CDS       T01804                                 

Gene name
ppcA
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cex  Caldisericum exile
Pathway
cex00680  Methane metabolism
cex01100  Metabolic pathways
cex01120  Microbial metabolism in diverse environments
cex01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cex00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CSE_13800 (ppcA)
  09102 Energy metabolism
   00680 Methane metabolism
    CSE_13800 (ppcA)
Enzymes [BR:cex01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CSE_13800 (ppcA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase_2
Motif
Other DBs
NCBI-ProteinID: BAL81506
UniProt: I0GL69
LinkDB All DBs
Position
1339307..1340767
Genome map
AA seq 486 aa AA seqDB search
MRKIPRCMSTQHPDNVSIPFFAKNPELDGEDEVMEAFYVFSHLGADEQMWDYEGKEGDDY
VVKKLLSKYKYFFKENRLGKDIFLTLRIPNPEFEVVEAKILLETLESIPRSFDTAYTVFK
DEISPIFEVILPMTTSAKSLERVYRYYTDFVVGKEEKPIFDSDIKVKDWVNEFKPKKIYV
IPLFEDFEHIVNADSIVEEYVKEKDFEYLRVFLARSDPAMNYGLISAVLIVKLALYKLWK
LSNRIGLPIYPIVGVGSAPFRGNLKPNNVLKIANEYRSVHTYTVQSSFKYDYPVNEVVEG
LKQLKGILPTNPKEIDEKFVLDFFKRGSLTYFLHVENLEPVINKVAKHIPSRRKRKLHVG
LFGYSRDNAKLKLPRAIAFTGSLYSIGVPPEILDLIAIEKDDYFKIKSLYENFESDLKDA
LKFANVDSPFFPKEVLRKLEEFGISFEVNEEHKELTKAIYSTVLDLKNYNLDELILRASL
IRKFIG
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagataccaagatgtatgagcacgcaacatcctgataatgtttcgataccattc
tttgcaaaaaatcccgaattggatggcgaagacgaggtaatggaagcattctatgtattt
tctcatcttggagcagacgaacagatgtgggactacgagggaaaagaaggcgatgattat
gttgttaaaaaacttctatcaaaatacaaatacttctttaaggaaaatagacttggaaag
gatattttcttaacattacgaattccaaatcctgaatttgaagtcgttgaagcaaaaatt
cttcttgaaacacttgaaagtatcccgcgttcttttgatacagcatacaccgtttttaaa
gacgaaatctcgccgatttttgaagtaatactaccaatgacaacatctgcaaaaagtctt
gaaagagtttatagatactatacagacttcgttgtaggaaaagaggaaaaaccaatcttt
gatagcgatataaaggttaaagattgggtaaatgaattcaagccaaagaaaatttatgta
atcccactttttgaagattttgaacatatagtaaatgccgattcaattgttgaagaatat
gtgaaggaaaaagattttgaatacttgagagttttccttgctcgttcggaccctgcaatg
aactacgggcttataagtgctgtactcatcgtaaaacttgcactctacaaattgtggaag
ctttctaataggattggccttccaatttatccaattgttggtgtaggctcggctccattt
agaggaaaccttaagccaaataacgtcttaaaaatagcaaatgaatatagaagcgttcat
acatacacggtacaatcatcttttaaatacgattatcctgttaatgaagttgttgaaggt
ttaaaacaactaaaagggatactccctacaaacccaaaagaaattgatgaaaaattcgtt
cttgatttctttaagcgcggttccttaacatatttcttgcatgtcgaaaatcttgagcct
gttataaacaaagttgcaaagcatattccttcaagaagaaaaagaaaactacatgtaggt
ctattcggatattcaagagacaatgcaaaactaaaacttccaagagcaatagcatttaca
ggaagcctttattcaattggcgttccacctgaaattctcgaccttattgcaattgaaaag
gatgattactttaaaattaagtctctctacgagaattttgagagtgatttaaaagatgct
ttgaaatttgcaaatgttgattctccattctttccaaaagaggttttaagaaaattagaa
gagtttgggatatcttttgaggttaatgaagagcataaagaacttacaaaagcaatatac
tcaacggtgcttgaccttaaaaattacaaccttgacgaacttatcttaagagcatcctta
attcgcaaatttatagggtaa

DBGET integrated database retrieval system