KEGG   Coxiella mudrowiae: CleRT_11630Help
Entry
CleRT_11630       CDS       T03998                                 

Definition
(GenBank) D-alanyl-D-alanine serine-type carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
cey  Coxiella mudrowiae
Pathway
cey00550  Peptidoglycan biosynthesis
cey01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cey00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CleRT_11630
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cey01002]
    CleRT_11630
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cey01011]
    CleRT_11630
Enzymes [BR:cey01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     CleRT_11630
Peptidases and inhibitors [BR:cey01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   CleRT_11630
Peptidoglycan biosynthesis and degradation proteins [BR:cey01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   CleRT_11630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Peptidase_S13
Motif
Other DBs
NCBI-ProteinID: AKQ33797
UniProt: A0A0H4VES1
LinkDB All DBs
Position
1271242..1272501
Genome map
AA seq 419 aa AA seqDB search
MKFLSSRARVIFFHVVSLSLSFGIVTAWAGDPNSTAQKNLTLAKTATNQVPETPPSLVPP
PPNLNVKGYVLMDANSGAIIAEKNMNQRLQPASLTKLMTLYLAFQALKSGQIHLDDKASV
SVSAWRTDGSRMFLKEGSSVPVDSLIQGIIVASGNDACVTVAQYIAGTEQTFAQMMNQTA
QRLGMKSSHYVDSQGLPNPDHYSTAYDIALLTRAIIKDFPEYYHFFSQKWLTYNNIKQPN
RNRLLWRDNSVDGLKTGHTEEAGYCLIASTQREGMRLISVVLGAPTDSDRADDSEALLNY
GFRFYQTQRLFNVHIPITQKRIWFGKEKYASFGLANPLYVTFPIGDNKNLKATIQFSEPH
LRAPLNEGQSYGVINISLNGKLMATAPLIALQKYSTAGLLSRMWDHIALFFKGIFSKAS
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttttatcttcccgcgcaagagtaattttttttcatgtagtcagcttgtctctt
tcttttgggatagtcactgcttgggcaggcgacccaaacagcacagctcaaaaaaatcta
actttagcaaaaactgctacgaatcaagtacccgaaacacctccctctttagtccctccg
cccccgaatttaaatgtaaaagggtatgtgttgatggacgccaattccggtgccattatc
gccgaaaaaaatatgaatcagcgccttcagcctgcaagcttaaccaaattaatgacgctt
tatttagctttccaagcgcttaagagtgggcaaatacacttagacgataaagcgagcgtc
agtgttagtgcatggagaacagacggttctcgcatgttcttaaaagagggctcaagtgta
cctgtcgattctctgatccaaggaataattgttgcttccggtaatgatgcgtgtgtgacc
gtagcccagtatattgctggcacagaacagacctttgcccaaatgatgaatcaaacggca
cagcgtctcggaatgaaaagttcacattatgtggattcccaaggattacccaatcccgat
cattactccaccgcttatgatatagctcttttaacccgtgctattattaaagactttcct
gaatattatcatttcttttctcagaaatggttaacctacaataatattaaacaacccaat
cgcaaccgcttgctctggcgtgataattccgtagacggtttaaaaacgggacataccgaa
gaggctggttattgtttaattgcatccacccaacgggaaggaatgcgcttaatttccgtg
gtgttgggagcacctactgatagcgaccgtgcggacgattccgaagcattgctaaattac
ggatttcgtttttatcaaactcaacggctatttaacgtccatattcccattactcagaaa
cggatttggttcggtaaggaaaaatacgcctcttttggtttagcaaatcctttatatgtt
acctttcctataggagataacaaaaatttaaaagccactatacaattttcagaaccgcat
ttacgagcaccgttaaatgaaggtcaatcctacggcgtcattaatatctcactcaatgga
aaattaatggctacagcacctttaattgcgctgcaaaaatattctacggcgggtttatta
tctcgaatgtgggatcatatagctttattctttaaagggatttttagcaaagcatcatga

DBGET integrated database retrieval system