KEGG   Cellulomonas sp. PSBB021: CBP52_01035Help
Entry
CBP52_01035       CDS       T04985                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
cez  Cellulomonas sp. PSBB021
Pathway
cez00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:cez00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    CBP52_01035
Enzymes [BR:cez01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     CBP52_01035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C Glyco_hydro_35 Glyco_hydro_2_C Glyco_hydro_14 DUF4434 DUF4350 Cellulase Nre_C
Motif
Other DBs
NCBI-ProteinID: ASR53965
UniProt: A0A222X6N2
LinkDB All DBs
Position
229998..232043
Genome map
AA seq 681 aa AA seqDB search
MTFASWPTGGAISFGGDYNPEQWPREVWQEDVALMREAGVNLVSVGIFSWGLIEVAEGEF
DFSWLDEVLDLLHAHGIAVDLGTPTASPPAWFFATYPQARVVAKDGTVLGFGSRGMASPS
SPEYRAAAVRIASRLAARYAHHPAVVMWHVHNEYGAPVGEDFSQNAVVAFREWLRARYES
LDALNAAWGTAFWGQHYTDWAHVSPPQPTPTVGNPAQKLDFARFCDHQLRACYIAERDAI
RAHATQPITTNFMANECPTTDLFAWAREVDVVSNDHYLTAADERNHVGLALAADLTRSVA
GGAPWILMEHSTSAVNWQPRNVAKRAGEMARNSLSHLARGADGILFFQWRASRSGAEKFH
SAMLPHAGTSSRVWREVVELGGHLRALAPVRGARVRAQAAILWDAESFWAQDLEWRPSVD
VQHKERVRAYYERLWRDGVTVDFVHPSQDLSGYRLVVAPASYLLRQADADNLTRYVEDGG
TLLVSFFSAVVDEHDAVHAGGYLAPLRDALGVEVEEFLPLRAGDSATVRWAPEGGEPVTL
TADVWQDDLVLHGAQVVGTYVDGPAAGGPAITRHAHGAGQGWYVSTRLGIDELAPVLAAV
YTDAGLESSGLPLDVEVVTRHGDGEDFVVAINHTADEVKVDLGAGQELLGATTVTGTVVI
PAGSVAVLRTTTPQLGGDGQP
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atgacctttgcgagctggcccaccggtggcgcgatctcgttcggtggcgactacaacccc
gagcagtggccgcgtgaggtgtggcaggaggacgtggccctcatgcgcgaggcgggcgtc
aacctggtgagcgtcgggatcttctcctggggactcatcgaggtcgcggagggggagttc
gacttctcgtggctcgacgaggtgctcgacctgctgcacgcgcacggcatcgcggtcgac
ctcgggaccccgaccgcgtcgccgcccgcgtggttcttcgccacctacccgcaggcgcgc
gtggtggcgaaggacgggacggtcctcggcttcgggtcgcgcgggatggcctcgccgagc
tcgcccgagtaccgcgctgcggcggtgcgcatcgcgtcgcggctcgcggcacgctacgcg
caccacccggcggtcgtgatgtggcacgtgcacaacgagtacggcgcgccggtcggcgag
gacttctcgcagaacgcggtcgtcgcgttccgcgagtggctgcgtgcgcggtacgagtcg
ctcgacgcgctcaacgcggcatggggcacggcgttctgggggcagcactacacggactgg
gcgcacgtctcgcccccgcagccgactccgacggtcggcaaccccgcgcagaagctcgac
ttcgcgcggttctgcgaccaccagctgcgcgcgtgctacatcgcggagcgcgacgcgatc
cgggctcacgcgacgcagccgatcaccacgaacttcatggcgaacgagtgcccgacgacc
gacctgttcgcgtgggcccgcgaggtcgacgtcgtctcgaacgaccactacctcaccgcg
gccgacgagcggaaccacgtgggcctggcgctcgccgccgacctcacgcggtcggtcgcg
ggcggtgcgccgtggatcctcatggagcactcgacgtcggccgtgaactggcagccgcgc
aacgtcgccaagcgagcgggggagatggcccgcaactcgctgtcgcacctcgcgcgcggc
gccgacgggatcctgttcttccagtggcgggcctcgcgctcgggtgcggagaagttccac
tcggcgatgctgccgcacgccggcacgtcgtcgcgggtgtggcgcgaggtcgtcgaactg
ggcgggcacctgcgcgcgctggcaccggtgcgcggtgcgcgggtgcgggcgcaggccgcg
atcctgtgggacgcggagtcgttctgggcgcaggacctcgagtggcgcccgtcggtggac
gtgcagcacaaggagcgggtgcgcgcctactacgagcggctgtggcgcgacggtgtcacc
gtcgacttcgtccacccgtcgcaggacctgtccggctaccgcctcgtcgtcgcgcccgcg
tcctacctgctgcggcaggcggacgccgacaacctcacgcggtacgtcgaggatggcggg
acgctgctcgtgtcgttcttctcggcggtcgtcgacgagcacgacgccgtgcacgcgggc
gggtacctcgccccgctgcgcgacgcgctcggcgtggaggtcgaggagttcctgccgctg
cgcgcgggcgacagcgcgacggtccgctgggcgcccgagggcggcgaacccgtgacgctg
accgccgacgtgtggcaggacgacctcgtgctgcacggcgcgcaggtcgtcgggacgtac
gtcgacggaccggccgcaggtggcccggcgatcacccggcacgcacacggggccgggcag
ggctggtacgtctcgacccggctcggcatcgacgagctcgcaccggtgctcgcggcggtg
tacaccgacgcgggcctggagtcctcggggctgcccctcgacgtcgaggtggtcacccgg
cacggcgacggcgaggacttcgtcgtcgcgatcaaccacaccgccgacgaggtcaaggtc
gacctcggtgcgggccaggagcttctcggcgccacgacggtgaccgggacggtcgtgatc
cccgccggctcggtcgccgtgctgcgcacgacgaccccgcagctcggaggtgatggccaa
ccgtag

DBGET integrated database retrieval system