KEGG   Cellulomonas sp. PSBB021: CBP52_01700Help
Entry
CBP52_01700       CDS       T04985                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
cez  Cellulomonas sp. PSBB021
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: ASR54071
UniProt: A0A222X7T9
LinkDB All DBs
Position
complement(391561..392625)
Genome map
AA seq 354 aa AA seqDB search
MRLPVMPPVAPMLAKSVKEIPDTGHVEPKWDGFRTIVFRDGDEVELGSRNEKPMTRYFPE
LVEQIKEHTPPRCVLDGEIVIVSGDRLDWDSLTNRIHPAASRVTLLAEQTPASFVAFDVL
ALGDDDLMSTPLVDRRARLTEALADAGGRVHVTPATADLDEARRWFTQFEGAGLDGVVAK
PLDGRYLPDKRSMFKVKHERTADCVVAGFRWHKSGPVVGSLLLGLWNDDGRLQHVGVVAS
FPMARRASLVDELAPLRDGVEDHPWAQWADEQAHAGQRLPGAVSRWNATKDLSFVPLRPE
LVVEVAYDHMEGDRFRHTGQFRRWRPDRDPATCTYAQLDEPVRFDLADILGLRP
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctgcccgtgatgccgcccgtcgcgcccatgctcgcgaagtcggtcaaggagatc
cccgacacgggacacgtcgagcccaagtgggacggcttccgcacgatcgtgttccgcgac
ggcgacgaggtggagctcggcagccgcaacgagaagccgatgacgcgctacttcccggag
ctggtcgagcagatcaaggaacacacgccgccgcggtgcgtgctcgacggggagatcgtc
atcgtctcgggcgaccggctggactgggactcgctgacgaaccgcatccacccggcggca
tcacgcgtgacgctcctcgcggagcagacgcccgcgagcttcgtggcgttcgacgtgctg
gcgctcggcgacgacgacctgatgtccacgccgctggtcgaccggcgcgcgcgcctgacg
gaggcgctggcggacgccggcggtcgcgtgcacgtgacgcccgcgacggcggacctcgac
gaggcgcggcgctggttcacgcagttcgagggcgcgggcctcgacggcgtggtggccaag
ccgctcgacggccgctacctgcccgacaagcgctccatgttcaaggtgaagcacgagcgc
accgcggactgcgtggtcgcggggttccggtggcacaagtcgggtccggtcgtcgggagc
ctgctgctcgggctgtggaacgacgacggccggctgcagcacgtgggtgtggtcgcgtcg
ttcccgatggcccgccgcgcgagcctcgtcgacgagctcgcgcccctgcgggacggcgtc
gaggaccacccgtgggcgcagtgggcggacgagcaggcgcacgccggtcagcggctcccg
ggggcggtgagccggtggaacgcgacgaaggacctcagcttcgtgccgttgcggcccgag
ctcgtcgtcgaggtggcgtacgaccacatggagggtgaccggttccggcacacgggccag
ttccggcggtggcggccggaccgtgacccggcgacgtgcacgtacgcccagctcgacgag
cccgtccggttcgacctcgcggacatcctgggcctgcgcccgtag

DBGET integrated database retrieval system