KEGG   Cellulomonas sp. PSBB021: CBP52_04755Help
Entry
CBP52_04755       CDS       T04985                                 

Definition
(GenBank) DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
cez  Cellulomonas sp. PSBB021
Pathway
cez03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:cez00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    CBP52_04755
Enzymes [BR:cez01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CBP52_04755
DNA repair and recombination proteins [BR:cez03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     CBP52_04755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C mRNA_cap_enzyme DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: ASR56725
UniProt: A0A222XEM6
LinkDB All DBs
Position
1057847..1058770
Genome map
AA seq 307 aa AA seqDB search
MLATPATSGGLPRGPGWAFEVKWDGVRAIADTTGPVLRLWSRAEREVTAAYPELAGLAEL
PDTVLDGEVVAMDAGIPSFPAIAERMHVRDPRRAAELARVRPVTYLVFDALRVAGVDLAT
RPYDERRAALEALVLPERVALSPVYTDGDELWSVTAAHGLEGVVAKRRASPYRPGARSPD
WVKAAHRHHVAALVGGWRDETSGSGRLGALLLGARDATGALRYLGRAGSGLTGALARRLH
DEVVPLAAATSPFDDEVPRVDARGTHWCAPTLVVQVRYLTRTPQGRLRQPVVLGVRDDTV
PDPWEAA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgctggccacccccgcgacctcgggcggtctgccgcgcggtcccggttgggcgttcgag
gtcaagtgggacggcgtgcgcgcgatcgcggacaccacgggcccggtgctgcggctgtgg
agccgcgcggagcgcgaggtgacggccgcgtacccggagctcgcggggctcgcggagctg
ccggacacggtgctcgacggcgaggtggtcgcgatggacgcgggcatcccgtcgttcccc
gcgatcgccgagcggatgcacgtgcgcgacccgcgtcgcgcggccgagctcgcccgggtc
cggcccgtgacgtacctcgtgttcgacgcgttgcgggtcgcgggcgtggacctcgcgacc
cgcccgtacgacgagcggagggcggcgctcgaggcgctcgtgctgcccgagcgcgtggcg
ctgtcgcccgtctacaccgacggcgacgagctctggtcggtcaccgccgcgcacggtctg
gagggcgtcgtcgccaagcgccgcgcgtcgccgtaccgtccgggcgcccgctcgcccgac
tgggtcaaggccgcccaccggcaccacgtcgccgcgctcgtcggcggctggcgcgacgag
acgagcgggtccggtcgcctgggcgcgctgctgctcggcgcgcgcgacgcgacgggggcg
ctgcggtacctcgggcgggcgggcagcggcctgacgggcgccctcgcgcgacgtctgcac
gacgaggtcgtgccgctcgccgcggccacgagcccgttcgacgacgaggtgccacgggtc
gacgcacgcggcacgcactggtgcgccccgacgctcgtcgtgcaggtgcgctacctgacc
cgcaccccgcagggccggctgcgccagccggtcgtgctcggggtgcgcgacgacacggtc
cccgacccctgggaggcggcatga

DBGET integrated database retrieval system