KEGG   Cellulomonas sp. PSBB021: CBP52_05930Help
Entry
CBP52_05930       CDS       T04985                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
cez  Cellulomonas sp. PSBB021
Brite
KEGG Orthology (KO) [BR:cez00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cez01001]
    CBP52_05930
Enzymes [BR:cez01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     CBP52_05930
Protein kinases [BR:cez01001]
 Serine/threonine kinases: Other
  Bacterial family
   CBP52_05930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr Kinase-like APH Pkinase_fungal Haspin_kinase Kdo
Motif
Other DBs
NCBI-ProteinID: ASR54723
UniProt: A0A222X9M2
LinkDB All DBs
Position
1307291..1309300
Genome map
AA seq 669 aa AA seqDB search
MGTAVTDPLVGRLVDGRYEVVSRIARGGMATVYLAVDRRLDRDVALKVMHPHLAEGGSGA
DFVARFRREARAAARLTHPGLVAVYDQGVDGETSYLTMEYVDGSNLRRRLAEQGALTVSE
ALRITESVLDALAAAHRGDLVHRDIKPENVLLATDGRIKLADFGLARAVTEVTSTTTGTV
LGTVAYLAPELVVRGASDARTDVYACGILLFEMLTGRQPFVGETPIQVAYQHVNSDVPAP
SDDLEWLPVEVDDLVRALAARDPDDRPVDAAAAVGLLRRARGELDDATLSRRADVAPSIV
LPAATDPDETPLPDGADAVPGDDGSTVRIEDLPRGSTVALPIGLGTGGSGPRAIAPAAAA
PAPARRPRRRLLAAVLALLVALGLGGAGWWYVVAGPGAYTTVPEIAGSSAEAARAALTAV
GLESTTTSEFSSDVAKGLVVTSDPAPGDKVRKDGTVEVTLSKGPDYVDVPDGVVGTLQAD
AEAALVAADLEVEYADPVYDDKAGLGVVVAAELPDGTPAKAGERTIRHTVVTLTTSKGPA
PVTVTSQVGAAADAAAKQLKGDGLKVRTTEEFSSDVKAGVVIRQSPEGGTRGHRGDTVTL
VVSKGPELFKVPDVMRNGIGSATDTLKAAGFEVEVRHAATYFGLGFVVGQEPGGGSMHPK
GTVVVLTIT
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
gtgggaaccgccgtcaccgatccgctcgtcggccgtctggtcgacggccggtacgaggtc
gtctcccggatcgcgcgcggcggcatggcgaccgtctacctcgcggtggaccgacggctc
gaccgtgacgtggcgctcaaggtcatgcacccccacctggcggagggcggctccggggcg
gacttcgtcgcgcggttccggcgcgaggcgcgagccgccgcacgcctcacccaccccggc
ctcgtcgcggtgtacgaccagggcgtcgacggcgagaccagctacctcacgatggagtac
gtcgacgggtccaacctgcgccgacgcctcgcggagcagggtgcgctcaccgtctccgag
gcgctgcgcatcaccgagtcggtgctggacgcgctcgccgcggcgcaccggggcgacctc
gtccaccgggacatcaagcccgagaacgtgctgctggccacggacggtcgcatcaagctc
gccgacttcgggctggcacgcgccgtcaccgaggtcacctcgaccaccacgggaacggtc
ctgggcacggtcgcgtacctcgcgcccgagctcgtcgtgcgcggcgcgagcgacgcccgc
accgacgtctacgcctgcgggatcctgctgttcgagatgctcacgggccgccagcccttc
gtcggcgagacgcccatccaggtcgcctaccagcacgtcaacagcgacgtgcccgcaccg
tccgacgacctcgagtggctccccgtcgaggtcgacgacctggtccgcgcgctcgccgca
cgcgatcccgacgaccggccggtcgacgcggccgccgcggtcggcctcctgcgccgcgcc
cgcggtgagctcgacgacgccacgctctcgcgccgcgcggacgtcgccccgtcgatcgtg
ctccccgccgcgacggaccccgacgagacacccctgcccgacggcgcggacgcggtcccc
ggcgacgacggctcgaccgtccgcatcgaggacctgccgcgcggctcgacggtcgcgctc
ccgatcgggctgggcaccggcggctccggacctcgcgcgatcgcgccggccgccgccgcg
cccgctcccgctcgtcgaccgcgtcgccggctgctcgccgcggtgctcgccctgctcgtg
gcgctcgggctcgggggcgcgggctggtggtacgtggtggccgggcccggcgcctacacg
accgtgcccgagatcgcgggatcgagcgccgaggccgcgcgtgccgcgctcaccgccgtc
gggctcgagtccacgaccacctccgagttctcgagcgacgtcgccaagggcctcgtcgtc
acgagcgatcccgcgccgggcgacaaggtccgcaaggacgggacggtcgaggtcaccctc
tccaagggacccgactacgtggacgtcccggacggggtcgtcggcacgctccaggcggac
gccgaggccgcgctcgtggcggcggacctcgaggtcgagtacgccgacccggtctacgac
gacaaggcggggctgggcgtcgtcgtcgcggccgagctccccgacggcaccccggcgaag
gccggtgagcgcacgatccggcacaccgtcgtgacgctgaccacctccaagggtcctgcg
cccgtgaccgtcacctcccaggtcggcgccgccgccgacgcggccgcgaagcagctcaag
ggcgacggcctcaaggtccgcacgaccgaggagttcagctccgacgtcaaggccggcgtc
gtgatccggcagtcgcccgagggcggcacccgggggcaccggggcgacaccgtgacgctc
gtcgtctcgaagggacccgagctgttcaaggtgccggacgtcatgcgcaacggcatcggg
tccgcgacggacacgctcaaggccgccggcttcgaggtcgaggtcaggcacgccgcgacg
tacttcggcctcgggttcgtggtcggtcaggagcccggtggcgggtcgatgcaccccaag
ggcacggtcgtcgtcctcacgatcacctga

DBGET integrated database retrieval system