KEGG   Cellulomonas sp. PSBB021: CBP52_07710Help
Entry
CBP52_07710       CDS       T04985                                 

Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
cez  Cellulomonas sp. PSBB021
Pathway
cez00473  D-Alanine metabolism
cez00550  Peptidoglycan biosynthesis
cez01100  Metabolic pathways
cez01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cez00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CBP52_07710
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CBP52_07710
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    CBP52_07710
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cez01011]
    CBP52_07710
Enzymes [BR:cez01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CBP52_07710
Peptidoglycan biosynthesis and degradation proteins [BR:cez01011]
 Precursor biosynthesis
  Amino acid ligase
   CBP52_07710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 Chal_sti_synt_C ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: ASR54997
UniProt: A0A222X816
LinkDB All DBs
Position
complement(1702312..1703466)
Genome map
AA seq 384 aa AA seqDB search
MNAQPQPADTSAPASSARPRVMVLFGGRSGEHAISCATAGGVLRALDRDRYDVLAVGITP
EGRWVLADDDPDRWAITEGRLPQVEDARAHVQLPQSSSDREVHLVSDGDVPLPLGEVDVV
FPLLHGPFGEDGTLQGMLELADVRYVGDGVLASAVGMDKHMMKLVFAGQGLPVGPFVVLL
PGAFDRDPQGQTERVRALGLPLFVKPARAGSSLGITRVDDLADLPAAVAEAQRHDPKVVV
EAAIVGREIECGVLGGHHGERARASLPGEIVVDAGKHAFYDFEAKYLDEAAVRLACPADL
PEHVTDRVREVAVQAFEALGCEGLARVDVFVTPDDEVIVNEINTMPGFTPFSMYPRMWEA
TGLTYPELVDELVRLALERPTGLR
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcccagccgcagcccgccgacacgagcgcccccgcttcctccgcccgtccccgc
gtcatggtcctgttcggcggccgctccggggagcacgcgatcagctgcgcgaccgcgggc
ggcgtgctgcgcgcgctcgaccgtgaccggtacgacgtcctcgcggtcgggatcacgccc
gaggggcgctgggtgctggcggacgacgacccggaccgctgggcgatcaccgaggggcgg
ctgccgcaggtcgaggacgcgcgtgcgcacgtgcagctcccgcagtcgtcgtcggaccgt
gaggtgcacctcgtctccgacggtgacgtgccgctcccgctcggtgaggtcgacgtggtg
ttcccgctgctgcacggcccgttcggcgaggacggcacgctccagggcatgctcgagctc
gcggacgtgcggtacgtcggcgacggcgtgctcgcctcggccgtcggcatggacaagcac
atgatgaagctcgtcttcgcgggccaggggctgcccgtcgggccgttcgtcgtgctcctg
cccggcgcgttcgaccgcgatccgcagggccagacggagcgggtgcgcgcgttggggctg
ccgctgttcgtcaagcccgcgcgcgccggctcgagcctgggcatcacgcgcgtcgacgac
ctcgccgacctgcccgcggcggtcgccgaggcgcagcgccacgacccgaaggtcgtcgtc
gaggccgcgatcgtgggccgcgagatcgagtgcggcgtgctcggcgggcaccacggcgag
cgggcgcgcgcgtcgctgccgggcgagatcgtcgtcgacgcgggcaagcacgcgttctac
gacttcgaggccaagtacctcgacgaggcggccgtgcggctggcgtgccccgccgacctg
cccgagcacgtcacggaccgcgtgcgcgaggtcgccgtgcaggcgttcgaggcgctcggg
tgcgagggcctcgcgcgcgtggacgtgttcgtcacgcccgacgacgaggtgatcgtcaac
gagatcaacaccatgcccgggttcacgccgttctcgatgtacccgcgcatgtgggaggcc
acggggctgacctacccggaactggtcgacgagctggtgcggctcgcgctcgagcgcccc
accggcctgcgctga

DBGET integrated database retrieval system