KEGG   Cellulomonas sp. PSBB021: CBP52_08855Help
Entry
CBP52_08855       CDS       T04985                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
cez  Cellulomonas sp. PSBB021
Pathway
cez00020  Citrate cycle (TCA cycle)
cez00480  Glutathione metabolism
cez01100  Metabolic pathways
cez01110  Biosynthesis of secondary metabolites
cez01120  Microbial metabolism in diverse environments
cez01130  Biosynthesis of antibiotics
cez01200  Carbon metabolism
cez01210  2-Oxocarboxylic acid metabolism
cez01230  Biosynthesis of amino acids
Module
cez_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cez_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:cez00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CBP52_08855
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CBP52_08855
Enzymes [BR:cez01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     CBP52_08855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ASR55168
UniProt: A0A222XAB4
LinkDB All DBs
Position
complement(1965806..1967023)
Genome map
AA seq 405 aa AA seqDB search
MAKIKVVGPVVELDGDEMTRIIWQFIKDRLIHPYLDIDLRYYDLSIENRDATDDQVTVDA
AHAIKEHGVGVKCATITPDEARVEEFGLKKMWLSPNGTIRNILGGVVFREPIIISNIPRL
VPGWNKPIIIGRHAHGDQYKATNFKVPGAGTLTLTFTPADGSEEIKQTVVTYPEAGGVAM
GMYNFNESIRDFARASFAYGLQRGYPVYLSTKNTILKAYDGAFKDIFQEVFDTEFKEQFD
AAGLTYEHRLIDDMVAAAMKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLMTPDG
KTVEAEAAHGTVTRHYRQHQQGKPTSTNPIASIFAWTGGLKHRGKLDGTPEVTAFAETLE
DVVVTTVESGKMTKDLALLIGPDQPWLTTEEFLAALDENLAARLG
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagatcaaggtcgtcggcccggtcgtcgagctcgacggcgacgagatgacgcgc
atcatctggcagttcatcaaggaccgcctgatccacccgtacctcgacatcgacctgcgg
tactacgacctgtcgatcgagaaccgcgacgcgaccgacgaccaggtgacggtcgacgcg
gcccacgcgatcaaggagcacggcgtcggcgtcaagtgcgcgacgatcacgccggacgag
gcgcgcgtcgaggagttcggcctcaagaagatgtggctgtccccgaacggcacgatccgc
aacatcctgggcggcgtcgtgttccgcgagccgatcatcatcagcaacatcccgcggctg
gtcccgggctggaacaagccgatcatcatcggtcgccacgcccacggcgaccagtacaag
gcgacgaacttcaaggtccccggcgccggcaccctcacgctgaccttcacgccggccgac
ggctccgaggagatcaagcagacggtcgtcacctacccggaggcgggcggcgtggcgatg
ggcatgtacaacttcaacgagtcgatccgcgacttcgcgcgcgcctcgttcgcgtacggg
ctgcagcgcggctacccggtgtacctctcgacgaagaacacgatcctcaaggcgtacgac
ggtgcgttcaaggacatcttccaggaggtgttcgacaccgagttcaaggagcagttcgac
gccgcgggcctgacgtacgagcaccgcctgatcgacgacatggtcgccgccgcgatgaag
tgggagggcggctacgtctgggcgtgcaagaactacgacggtgacgtgcagtccgacacg
gtcgcgcagggcttcggctcgctgggcctgatgacgtcggtgctcatgacgccggacggc
aagaccgtcgaggccgaggcggcgcacggcacggtgacgcggcactaccgccagcaccag
cagggcaagccgacgtcgacgaacccgatcgcgtcgatcttcgcgtggacgggcggtctg
aagcaccgcggcaagctcgacggcacgcccgaggtcacggcgttcgccgagacgctcgag
gacgtcgtcgtcacgacggtcgagagcggcaagatgacgaaggacctcgcgctgctcatc
ggcccggaccagccgtggctgacgacggaggagttcctcgcggcgctcgacgagaacctg
gcggcgcgcctgggctga

DBGET integrated database retrieval system