KEGG   Canis familiaris (dog): 100686744Help
Entry
100686744         CDS       T01007                                 

Gene name
PRSS2
Definition
(RefSeq) anionic trypsin
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04080  Neuroactive ligand-receptor interaction
cfa04972  Pancreatic secretion
cfa04974  Protein digestion and absorption
cfa05164  Influenza A
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100686744 (PRSS2)
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    100686744 (PRSS2)
   04974 Protein digestion and absorption
    100686744 (PRSS2)
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05164 Influenza A
    100686744 (PRSS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cfa01002]
    100686744 (PRSS2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cfa04147]
    100686744 (PRSS2)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     100686744 (PRSS2)
Peptidases [BR:cfa01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100686744 (PRSS2)
Exosome [BR:cfa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100686744 (PRSS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 100686744
NCBI-ProteinID: XP_003432104
Ensembl: ENSCAFG00000014481
UniProt: P06872
LinkDB All DBs
Position
16
AA seq 247 aa AA seqDB search
MNPLLILAFLGAAVATPTDDDDKIVGGYTCEENSVPYQVSLNAGYHFCGGSLISDQWVVS
AAHCYKSRIQVRLGEYNIDVLEGNEQFINSAKVIRHPNYNSWILDNDIMLIKLSSPAVLN
ARVATISLPRACAAPGTQCLISGWGNTLSSGTNYPELLQCLDAPILTQAQCEASYPGQIT
ENMICAGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCAQKNKPGVYTKVCNFVDWIQ
STIAANS
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaatccactcctgatccttgcttttcttggagctgctgttgctacccccacagacgac
gatgacaagatcgtcgggggctacacctgtgaggagaattccgtcccctaccaggtgtcc
ctgaatgcaggctatcacttctgcgggggctccctcatcagtgaccagtgggtggtgtcc
gcggctcactgctacaagtcccgcatccaagtgagactcggagagtacaacatcgatgtc
ctggaggggaatgagcagttcatcaactccgccaaggtcatccgccatcccaactataac
agctggatcctggacaatgacatcatgctcatcaagctctcctcacctgcggtcctcaat
gcccgggtggccaccatatctctgcccagggcctgcgcagcccctggcacccagtgcctc
atctccggctggggcaacaccctgagctctggcaccaactaccccgagctgctgcagtgc
ctggacgccccaatcctgactcaggcccagtgcgaagcctcctaccccggccagatcacg
gagaacatgatttgcgccggcttcctcgagggaggcaaggactcctgccagggtgactct
ggtggcccagtggtctgcaatggagagctccagggaatcgtctcctggggctacggctgt
gcccagaagaacaaacctggagtctacaccaaggtgtgcaacttcgtagactggattcag
tcgaccatagctgccaacagctaa

DBGET integrated database retrieval system