KEGG   Canis familiaris (dog): 100686967Help
Entry
100686967         CDS       T01007                                 

Gene name
LIG1
Definition
(RefSeq) DNA ligase 1 isoform X1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa03030  DNA replication
cfa03410  Base excision repair
cfa03420  Nucleotide excision repair
cfa03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    100686967 (LIG1)
   03410 Base excision repair
    100686967 (LIG1)
   03420 Nucleotide excision repair
    100686967 (LIG1)
   03430 Mismatch repair
    100686967 (LIG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cfa03032]
    100686967 (LIG1)
   03400 DNA repair and recombination proteins [BR:cfa03400]
    100686967 (LIG1)
Enzymes [BR:cfa01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     100686967 (LIG1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     100686967 (LIG1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     100686967 (LIG1)
DNA replication proteins [BR:cfa03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    100686967 (LIG1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     100686967 (LIG1)
DNA repair and recombination proteins [BR:cfa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     100686967 (LIG1)
   NER (nucleotide excision repair)
    Other NER factors
     100686967 (LIG1)
   MMR (mismatch excision repair)
    Other MMR factors
     100686967 (LIG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DDR PucR Presenilin
Motif
Other DBs
NCBI-GeneID: 100686967
NCBI-ProteinID: XP_005616429
Ensembl: ENSCAFG00000004046
VGNC: 42673
LinkDB All DBs
Position
1
AA seq 913 aa AA seqDB search
MQRSIMSFFYPKKEGKAKKPEKETSNSIRETEPPPKVALKERNGEVPESDSPVKRPGRKV
ARVLGSEGEEEDEALTPSKGQKPAPGSPQVSPPSPVTYPESSPSLSSTSPVDISAGIPKR
RTARKQLPKRTIQDVLEEQSKDEDREAKKKKEEEAETPPESLSESEVTQEKEAEGEDQPV
TSPEHRETSPEPPVDSTLEPAVSGKQEAQNEDLAKPPTRAPKTVSSFFAPRKPATKKEGK
EEDPGTPRQEETKGPLDPPSYNPAKNNYHPIDDACWKPGQKVPYLAVARTFEKIEEVSAR
LRMVETLSNLLRSVVALSPPDLLPILYLSLNRLGPPQQGLELGVGDGVLLKAVAQATGRQ
LDSVKAEAAEKGDVGLVAENSRSTQRLMLPPPALTAAGVFAKFRDIARLAGSASTAKKID
VIKGLFVACRHSEARFIARALSGRLRLGLAEQSVLAALAQAVSLTPPGQEFPPAVVDAGK
GRTAEARKTWLEEQGMILKQTFCEVPDLDRIIPVLLEHGLEHLPEHCRLSPGVPLKPMLA
HPTRGVSEVLKRFEEAAFTCEYKYDGQRAQIHVLEGGEVKIFSRNQEDNTGKYPDIISRI
PKIKLPSVTSFILDTEAVAWDREKKQIQPFQVLTTRKRKEVDAAEIQVQVCLYAFDLIYL
NGESLVREPLSRRRQLLRENFVETEGEFVFATSLDTKDTDQIAEFLEQSVKDSCEGLMVK
TLDVDATYEIAKRSHNWLKLKKDYLDGVGDTLDLVVIGAYLGRGKRAGRYGGFLLAAYDE
ESEELQAICKLGTGFSDEELEEHYQRLQALVLPTPRSYVRVDGAVAPDHWLDPSAVWEVK
CADLSLSPIYPAARGLVDGEKGISLRFPRFIRVREDKKPEEATTSGQVACLYMKQSQIQN
QQGADLDSDSDFY
NT seq 2742 nt NT seq  +upstreamnt  +downstreamnt
atgcagcggagtatcatgtcatttttctaccccaagaaggagggcaaagcgaaaaagcca
gagaaggagacctccaacagcatcagagagacagagccacccccaaaggtggcactgaag
gagcggaatggagaggtgcctgaaagcgattctccagtgaagaggccagggcggaaggtg
gcccgggtcctgggcagtgaaggggaggaggaggacgaagccctcacgccatccaaaggc
cagaaacctgccccaggctctccacaagtctcccctcccagccctgtcacatatcccgag
agcagcccttccctctccagtacctctcctgtggacatctcagcagggatcccaaagcgg
cgcactgctcggaagcagcttcctaagcggacaatacaggatgtcctggaagagcagagc
aaggatgaggacagagaggccaagaagaagaaggaagaagaagcagagaccccaccagaa
agcctgtcagaatctgaagtgacccaagagaaggaggcagaaggggaggaccaacctgtg
acatcccctgagcaccgagagacctccccagagcccccggtggatagcacgttggagcct
gcggtgtctgggaagcaggaggctcagaacgaggacttggctaagccgcccaccagagcc
cccaagacggtcagcagcttctttgccccgcggaaaccggcaaccaagaaagaagggaaa
gaagaggaccctggcactccaaggcaggaggagaccaagggacccctggaccctcccagc
tacaatcctgccaagaacaactaccatcccattgatgatgcatgctggaagccaggccag
aaggtcccttacctggctgtggcccggacatttgagaagattgaggaagtttctgctcgg
ctccggatggtggagacgctgagcaacttgctgcgctctgtggtggccctgtcacctccg
gacctccttcctatcctctacctcagcctcaaccgtcttgggccaccccagcagggtctg
gaacttggtgtcggtgatggtgttctcctcaaggcggtggcccaggccacagggcggcag
ctggactctgttaaggcagaggcagctgagaagggtgacgtggggctggtggccgaaaac
agccgcagtacccagaggctcatgctgcccccacctgctctcaccgctgccggggtcttc
gccaagttccgagacattgcccggcttgctggcagtgcctccacagccaagaagatagat
gtcatcaaaggcctcttcgtcgcctgccgccactcagaagcccgattcattgccagggcc
ctgagtggacggctgcgcctcgggctggcagagcagtcggtgctggctgccctcgcccag
gccgtgagcctcacgcccccaggccaagaattccccccggccgttgtggatgctgggaag
ggccggacagcagaagcccgaaagacgtggctggaggagcaaggcatgatcctgaagcag
acgttctgcgaggtgcccgacctggaccggatcatccctgtactgctggagcatggcctg
gagcacctccctgagcactgcaggttgagcccaggggttccactgaaaccaatgctggcg
caccccacccggggtgtcagcgaggtcctaaaacgttttgaagaggcagctttcacctgc
gagtacaaatacgatgggcagagggcacagatccacgttctggaaggtggggaggtgaag
atcttcagcaggaatcaggaagacaataccggaaagtacccagacatcatcagccgcatt
cccaagattaaactcccgtcagtcacgtctttcattctggacacagaagctgtggcatgg
gaccgagaaaagaagcagatccagccattccaagtgctcaccacccgcaaacgcaaggag
gtggatgcagcagagatccaggtgcaggtgtgtctatatgccttcgacctcatttacctc
aatggagagtccctggtacgtgagcctctttcccgacgccggcagctgctccgggagaac
tttgtggagacggagggcgagtttgtgttcgccacctccctggacaccaaggacacggac
caaattgccgagttcttagagcagtctgtgaaagactcctgtgaggggctgatggtgaaa
actctggacgttgatgccacctatgagatcgccaagagatcccacaactggctcaagctg
aagaaggactacctcgatggtgtgggcgacaccctggacctcgtggtgattggcgcctac
ctgggccgtggcaaacgggctggccgctatgggggcttcctactggctgcctacgacgag
gagagtgaggagctccaggccatatgcaagctcggaactggcttcagtgacgaggaactg
gaggagcactaccagaggctccaggccctggtgctgcccaccccacgctcctatgtccgg
gtcgacggtgccgtggcccccgatcactggctggaccccagtgccgtgtgggaggtgaag
tgtgcggatctgtccttgtcgcccatctaccctgctgcccggggcctggtggatggtgag
aaggggatctcccttcgctttcctcggtttatccgggtccgtgaagacaagaagccagag
gaggccaccaccagtggccaggtggcctgcctgtacatgaagcagagtcagattcagaac
cagcagggcgcggacttagactctgactcagatttctactag

DBGET integrated database retrieval system