KEGG   Canis lupus familiaris (dog): 403431
Entry
403431            CDS       T01007                                 

Gene name
TGFA
Definition
(RefSeq) protransforming growth factor alpha
  KO
K08774  transforming growth factor, alpha
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa01521  EGFR tyrosine kinase inhibitor resistance
cfa04010  MAPK signaling pathway
cfa04012  ErbB signaling pathway
cfa04014  Ras signaling pathway
cfa04151  PI3K-Akt signaling pathway
cfa04915  Estrogen signaling pathway
cfa05200  Pathways in cancer
cfa05210  Colorectal cancer
cfa05211  Renal cell carcinoma
cfa05212  Pancreatic cancer
cfa05214  Glioma
cfa05215  Prostate cancer
cfa05223  Non-small cell lung cancer
cfa05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    403431 (TGFA)
   04012 ErbB signaling pathway
    403431 (TGFA)
   04014 Ras signaling pathway
    403431 (TGFA)
   04151 PI3K-Akt signaling pathway
    403431 (TGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    403431 (TGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    403431 (TGFA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    403431 (TGFA)
   05212 Pancreatic cancer
    403431 (TGFA)
   05225 Hepatocellular carcinoma
    403431 (TGFA)
   05214 Glioma
    403431 (TGFA)
   05211 Renal cell carcinoma
    403431 (TGFA)
   05215 Prostate cancer
    403431 (TGFA)
   05223 Non-small cell lung cancer
    403431 (TGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    403431 (TGFA)
SSDB
Motif
Pfam: EGF EGF_2 TMEM154
Other DBs
NCBI-GeneID: 403431
NCBI-ProteinID: XP_022280575
LinkDB
Position
10
AA seq 193 aa
MRWHAGSGPYLPLGDVSSARPPVAAAVVSHFNDCPDSHSQFCFHGTCRFLVQEDKPACVC
HSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIIACVLIHCCQVRKHCEWC
QALLCRHEKPSALLKGRAACCHSETGKGRKGPRQGHSGRRSPLPPPLTSPGQGPGRGGLF
NLQEPLKRPPQGC
NT seq 582 nt   +upstreamnt  +downstreamnt
atgcgatggcacgcggggtccgggccttacctgccccttggggacgtgagctcagcacgc
ccgcccgtggccgccgccgtggtgtcccacttcaacgactgcccggactcccacagccag
ttctgcttccatggaacctgcaggtttctggtgcaggaggacaagcccgcgtgcgtctgc
cactccgggtacgtcggggcgcgctgtgagcacgccgacctcctggccgtggtggccgcc
agccagaagaagcaggccatcaccgccctggtggtggtctccatcgtggccctggccgtc
ctcatcatcgcgtgtgtgctgatacactgctgccaggtccggaagcactgtgagtggtgc
caggccctcctgtgccggcacgagaagcccagcgccctgctgaagggaagggccgcctgc
tgccactcggagacaggtaaggggcgtaaggggccgcgccaggggcacagtgggcggagg
agcccccttccccctcccctcacctccccggggcaggggccgggcaggggcggcttgttc
aatctccaggagcctctcaagaggcctcctcaaggatgctaa

DBGET integrated database retrieval system