KEGG   Canis lupus familiaris (dog): 403507
Entry
403507            CDS       T01007                                 

Gene name
KITLG
Definition
(RefSeq) kit ligand precursor
  KO
K05461  KIT ligand
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa04010  MAPK signaling pathway
cfa04014  Ras signaling pathway
cfa04015  Rap1 signaling pathway
cfa04072  Phospholipase D signaling pathway
cfa04151  PI3K-Akt signaling pathway
cfa04640  Hematopoietic cell lineage
cfa04916  Melanogenesis
cfa05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    403507 (KITLG)
   04014 Ras signaling pathway
    403507 (KITLG)
   04015 Rap1 signaling pathway
    403507 (KITLG)
   04072 Phospholipase D signaling pathway
    403507 (KITLG)
   04151 PI3K-Akt signaling pathway
    403507 (KITLG)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    403507 (KITLG)
  09152 Endocrine system
   04916 Melanogenesis
    403507 (KITLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    403507 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cfa04052]
    403507 (KITLG)
Cytokines and growth factors [BR:cfa04052]
 Growth factors
  Growth factors (RTK binding)
   403507 (KITLG)
SSDB
Motif
Pfam: SCF Psg1
Other DBs
NCBI-GeneID: 403507
NCBI-ProteinID: NP_001012753
Ensembl: ENSCAFG00000006091
VGNC: 42423
UniProt: Q06220
LinkDB
Position
15
AA seq 274 aa
MKKTQTWIITCIYLQLLLFNPLVKTKGICGKRVTDDVKDVTKLVANLPKDYKIALKYVPG
MDVLPSHCWISVMVEQLSVSLTDLLDKFSNISEGLSNYSIIDKLVKIVDDLVECTEGYSF
ENVKKAPKSPELRLFTPEEFFRIFNRSIDAFKDLETVASKSSECVVSSTLSPDKDSRVSV
TKPFMLPPVAASSLRNDSSSSNRKASNSIGDSNLQWAAMALPAFFSLVIGFAFGALYWKK
KQPNLTRTVENIQINEEDNEISMLQEKEREFQEV
NT seq 825 nt   +upstreamnt  +downstreamnt
atgaagaagacacaaacttggattatcacttgcatttatcttcagctgctcctatttaat
cctctggtcaaaactaaagggatctgcgggaaacgtgtgactgatgatgtgaaggacgtt
acaaaattggtggcaaatcttccaaaagactataagatagccctcaaatatgtccccggg
atggatgttttgcctagtcattgttggataagcgtgatggtggaacagttgtcagtcagc
ttgactgatcttctggacaagttttcaaatatttctgaaggcctgagtaattattctatc
atagacaaacttgtgaaaatagtggatgatcttgtggagtgcacagaaggatactcattt
gagaatgtaaaaaaagcacctaagagcccagaactcaggctttttactcctgaagaattc
tttagaatttttaatagatccatcgatgcctttaaggacttggagacggtggcatctaaa
agtagtgaatgtgtggtttcttcaaccttaagtcctgataaagattccagagtcagtgtc
acaaaaccatttatgttaccccctgttgcagccagctcccttaggaatgacagcagtagc
agtaataggaaggcctcaaattccattggagactccaacttacaatgggcagccatggca
ttgccagcattcttttctcttgtaattgggtttgcttttggagccttatactggaagaag
aaacaaccaaatctcacaaggacagttgaaaatatacagattaatgaagaggataatgaa
ataagtatgttgcaagagaaagagagggagtttcaagaggtgtaa

DBGET integrated database retrieval system