KEGG   Canis lupus familiaris (dog): 403516
Entry
403516            CDS       T01007                                 

Gene name
CACNA1C
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C isoform X29
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa04010  MAPK signaling pathway
cfa04020  Calcium signaling pathway
cfa04022  cGMP-PKG signaling pathway
cfa04024  cAMP signaling pathway
cfa04260  Cardiac muscle contraction
cfa04261  Adrenergic signaling in cardiomyocytes
cfa04270  Vascular smooth muscle contraction
cfa04713  Circadian entrainment
cfa04720  Long-term potentiation
cfa04723  Retrograde endocannabinoid signaling
cfa04724  Glutamatergic synapse
cfa04725  Cholinergic synapse
cfa04726  Serotonergic synapse
cfa04727  GABAergic synapse
cfa04728  Dopaminergic synapse
cfa04742  Taste transduction
cfa04911  Insulin secretion
cfa04912  GnRH signaling pathway
cfa04921  Oxytocin signaling pathway
cfa04924  Renin secretion
cfa04925  Aldosterone synthesis and secretion
cfa04927  Cortisol synthesis and secretion
cfa04929  GnRH secretion
cfa04930  Type II diabetes mellitus
cfa04934  Cushing syndrome
cfa04935  Growth hormone synthesis, secretion and action
cfa05010  Alzheimer disease
cfa05020  Prion disease
cfa05022  Pathways of neurodegeneration - multiple diseases
cfa05031  Amphetamine addiction
cfa05410  Hypertrophic cardiomyopathy
cfa05412  Arrhythmogenic right ventricular cardiomyopathy
cfa05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    403516 (CACNA1C)
   04020 Calcium signaling pathway
    403516 (CACNA1C)
   04024 cAMP signaling pathway
    403516 (CACNA1C)
   04022 cGMP-PKG signaling pathway
    403516 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    403516 (CACNA1C)
   04929 GnRH secretion
    403516 (CACNA1C)
   04912 GnRH signaling pathway
    403516 (CACNA1C)
   04921 Oxytocin signaling pathway
    403516 (CACNA1C)
   04935 Growth hormone synthesis, secretion and action
    403516 (CACNA1C)
   04924 Renin secretion
    403516 (CACNA1C)
   04925 Aldosterone synthesis and secretion
    403516 (CACNA1C)
   04927 Cortisol synthesis and secretion
    403516 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    403516 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    403516 (CACNA1C)
   04270 Vascular smooth muscle contraction
    403516 (CACNA1C)
  09156 Nervous system
   04724 Glutamatergic synapse
    403516 (CACNA1C)
   04727 GABAergic synapse
    403516 (CACNA1C)
   04725 Cholinergic synapse
    403516 (CACNA1C)
   04728 Dopaminergic synapse
    403516 (CACNA1C)
   04726 Serotonergic synapse
    403516 (CACNA1C)
   04720 Long-term potentiation
    403516 (CACNA1C)
   04723 Retrograde endocannabinoid signaling
    403516 (CACNA1C)
  09157 Sensory system
   04742 Taste transduction
    403516 (CACNA1C)
  09159 Environmental adaptation
   04713 Circadian entrainment
    403516 (CACNA1C)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    403516 (CACNA1C)
   05020 Prion disease
    403516 (CACNA1C)
   05022 Pathways of neurodegeneration - multiple diseases
    403516 (CACNA1C)
  09165 Substance dependence
   05031 Amphetamine addiction
    403516 (CACNA1C)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    403516 (CACNA1C)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    403516 (CACNA1C)
   05414 Dilated cardiomyopathy
    403516 (CACNA1C)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    403516 (CACNA1C)
   04934 Cushing syndrome
    403516 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:cfa04040]
    403516 (CACNA1C)
Ion channels [BR:cfa04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   403516 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel Etmic-2 DUF4834
Other DBs
NCBI-GeneID: 403516
NCBI-ProteinID: XP_013963768
Ensembl: ENSCAFG00000016051
VGNC: 38633
LinkDB
Position
27
AA seq 2170 aa
MLRAFGQPSVPAYQPLSSHSAAEAEVKFKGTLVHEAQLNCFYIPPGGSNYGSPRPAHANM
NANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTVSSTQRKRQQYGKPK
KQGSTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPED
DSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSA
ILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLH
IALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVPAEDDPSPCALETGHGRQCQNGT
VCKPGWDGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVYFVSLVI
FGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPE
NEDEGMDEEKPRNMSMPTSETESVNTENVAGGDIEGENCGARLAHRISKSKFSRYWRRWN
RFCRRKCRAAVKSNVFYWLVIFLVFLNTLTIASEHYNQPHWLTEVQDTANKALLALFTAE
MLLKMYSLGLQAYFVSLFNRFDCFIVCGGILETILVETKIMSPLGISVLRCVRLLRIFKI
TRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQTRRSTFD
NFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLA
IAVDNLADAESLTSAQKEEEEEKERKKLARTASPEKKQEIVEKPAVEETKEEKIELKSIT
ADGESPPTTKINMDDLQPNENEDKSPYPNPENTGEEDEEEPEMPVGPRPRPLSELHLKEK
AVPMPEASAFFIFSPNNRFRLQCHRIVNDTIFTNLILFFILLSSISLAAEDPVQHTSFRN
HILGNADYVFTSIFTLEIILKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISFGIQSSA
INVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQL
FKGKLYTCSDSSKQTEAECKGNYITYKDGEVDHPIIQPRSWENSKFDFDNVLAAMMALFT
VSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQ
EQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQHQYKVWYVVNSTYFEYLMFVLIL
LNTICLAMQHYGQSCLFKIAMNILNMLFTGLFTVEMILKLIAFKPKHYFCDAWNTFDALI
VVGSIVDIAITEVNPAEHTQCSPFMNAEENSRISITFFRLFRVMRLVKLLSRGEGIRTLL
WTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQAVLLLF
RCATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPCGSSFAVFYFISFYMLCAFLIINL
FVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGF
GKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGNLEQANEELRAIIK
KIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPSQRNALS
LQAGLRTLHDIGPEIRRAISGDLTAEEELDKAMKEAVSAASEDDIFRRAGGLFGNHVSYY
QSDGRSAFPQTFTTQRPLHINKAANSQGDAESPSHEKLVDSTFTPSSYSSTGSNANINNA
NNTGLGRFPPPSGYPGAASTAEGHGTPLSPAGRVQEAAWKLSSKRCHSRESQIAMVCQEE
VSQDETYDVKMSEDAEYCSEPSLISTEMLSYQDDENRQLTPPEEDKRDVRQSPKRGFLRS
ASLGRRASFHLECLKRQKNQAGDISQKTVLPLHLVHHQALAVAGLSPLLQRSHSPGTLPR
PCATPPATPGSRGWPPQPIPTLRLEGAESNEKLNSSFPSIHCSSWSEEPTPCGGGDSTIR
RARPVSLTVPSQAGARGRQFHGSASSLVEAVLISEGLGQFAQDPKFIEVTTQELADACDM
TIEEMENAADNILSGGAQQSPNGTLLPFVNCRDPGQDKAGGHVGDACTAALACQKSEEEL
QDSRAHTGSL
NT seq 6513 nt   +upstreamnt  +downstreamnt
atgcttcgagcctttggccagccctctgtgcctgcataccagccgctttccagccactct
gctgctgaagcagaggtgaagtttaagggcactttggtgcatgaagctcaactcaactgc
ttctacatccctcctggaggttccaactatgggagcccacgcccagctcatgccaacatg
aacgccaatgcagctgcgggactcgcccctgagcacatccccacgccgggtgcggccttg
tcgtggcaggcggccatcgatgcagcccggcaggccaagctgatgggcagcgccggcaac
gcgaccatttccacggtcagctccacgcagcggaagcggcagcagtatgggaaacccaag
aagcagggcagcacaacggccacgcgcccaccccgcgccctactttgcctgactctgaag
aaccccatccggagggcgtgcatcagcatcgtcgaatggaaaccatttgaaataattatt
ttactgactatttttgccaattgtgtggccttagcgatctatattccctttccagaagac
gactccaatgccaccaattccaacctggaacgagtggaatatctctttctcataattttt
actgtggaagcatttttaaaagtaatagcctatggacttctctttcaccccaacgcttac
ctccgcaatggttggaatttactagattttataattgtggttgtagggcttttcagtgca
attttagaacaagcaaccaaagccgatggggcaaatgctctaggaggaaaaggagctgga
tttgacgtgaaggcactgagagcattccgtgtgctgcgccccttgaggctggtgtctgga
gtcccaagtctccaggtggttctgaattccattatcaaggccatggtgcccctgctgcat
attgccctgttagtgctgtttgtcattatcatctatgccataatcggcttggagctcttc
atggggaaaatgcataagacctgctacaaccaggaaggcatagcagatgttccagcagaa
gatgatccttccccttgtgctctggaaacaggccatgggcggcagtgccagaatggcact
gtgtgcaagcccgggtgggatgggcccaagcatggcatcaccaactttgacaattttgcc
ttcgccatgttgacggtattccagtgcatcaccatggagggctggacagatgtgctgtac
tggatgcaggacgctatgggctatgagttaccctgggtgtattttgtcagtctggtcatc
tttggatcctttttcgttctaaatctggttctcggtgtgttgagcggagagttttccaaa
gagagggagaaggccaaagctcggggagatttccagaagcttcgagagaagcagcagctg
gaagaggacctaaagggctacctggactggatcacccaggcagaggacatcgaccctgag
aatgaggatgaaggcatggatgaggagaagccccgaaacatgagcatgcccacaagcgag
accgagtctgtcaacaccgaaaacgtggctggaggtgacatcgagggagagaactgcggg
gccagactggcccaccggatttctaaatcaaagttcagccgctactggcgccggtggaat
cggttctgcagaagaaagtgtcgtgctgcagtcaagtctaatgtcttctactggcttgtg
atcttcctggtgttcctcaacacactcaccatcgcctcagaacactacaatcagccccac
tggctcacagaggtccaagacacggccaacaaggcactactggccctttttacggcagag
atgctgctgaagatgtatagcctgggcctgcaggcctactttgtgtccctcttcaaccgc
ttcgactgcttcatcgtgtgtgggggcatcctggagaccatcctggtggagaccaagatc
atgtctcccttgggcatctctgtgctgagatgtgtccggctcctacggatatttaaaatc
acaagatactggaactccttaagcaacctggtggcatccttgctgaattctgtgcgttcc
atcgcctccctgctgctactcctctttctcttcatcatcatcttctccctcctggggatg
cagctctttggaggaaagttcaactttgatgaaatgcagactcggaggagcacatttgat
aactttccgcagtccctcctcaccgtgtttcagatcctgaccggggaggactggaattcg
gtgatgtatgatgggatcatggcttatggcggcccctcttttccagggatgttagtctgt
atttacttcatcatcctcttcatctgtggaaactatatcctactgaatgtgttcttggcc
attgctgtggacaacctggctgatgctgagagcctcacatctgcccaaaaggaggaggaa
gaagagaaagagagaaagaagctggccaggactgccagcccagagaagaaacaagagata
gtggagaagccagcagtggaggaaaccaaggaggaaaaaattgaactgaaatccattaca
gctgatggagagtccccacccaccactaagatcaacatggatgacctccagcccaatgaa
aatgaggataagagtccctaccccaacccagaaaatacaggagaagaggatgaggaggag
cctgagatgcctgtgggcccccgcccacgaccactctctgagctgcaccttaaggaaaag
gcagtgcccatgccagaagccagtgcgtttttcatcttcagccccaacaacagatttcgc
ctccagtgccaccgcattgtcaatgacacgatcttcaccaacctgatcctcttcttcatt
ctgctcagcagcatttccctggcagctgaagatcccgtccagcacacctccttcaggaac
catatcctaggcaatgcagactatgtcttcactagtatctttacattagaaattatcctt
aagatgactgcttatggggctttcctacataagggctctttttgccggaactacttcaac
atcttggacctgttggtggtcagcgtgtccctcatttcctttggcatccagtccagtgca
atcaatgtggtgaagattttacgagttttgcgagtcctcaggcccctgagggccatcaac
agagccaaggggctaaagcacgtggttcagtgcgtgttcgtcgccatccggaccatcggg
aacatcgtgattgtcaccacactgcttcaattcatgttcgcctgcattggggtccagctt
ttcaagggaaagctctacacctgttcagatagttccaaacagaccgaggcggaatgcaag
ggtaactacatcacatacaaggacggggaggttgaccaccccatcatccaaccccgcagc
tgggagaacagcaagtttgactttgacaatgttctggcagccatgatggccctttttacc
gtctctacctttgaagggtggccagagctgctgtaccgttccatcgactcccacacagaa
gacaagggccccatctacaactaccgtgtggagatctccatctttttcatcatctacatc
atcatcattgccttcttcatgatgaacatcttcgtgggtttcgttatcgtcaccttccag
gagcagggggagcaggaatacaagaactgtgagctggacaagaaccagcgacagtgcgtg
gaatatgccctcaaggcccggcccctgcggaggtacatccccaagaaccagcaccagtac
aaagtgtggtatgtggtcaactccacctactttgaatacctgatgttcgtcctcatcctg
ctcaacaccatctgcttggccatgcagcactatggccagagctgcctattcaaaattgcc
atgaacatcctcaacatgctcttcactggcctcttcaccgtggagatgattctgaagctc
attgccttcaaacccaagcactatttctgtgatgcatggaatacatttgacgccttgatt
gttgtgggtagcattgttgatatagcaatcaccgaggtaaacccagctgaacatacccaa
tgctctccctttatgaatgcagaggagaactcccgcatctccatcaccttcttccgcctc
ttccgggtcatgcgcctggtcaagctgctgagccgaggggagggcatccggaccctgctg
tggaccttcatcaaatccttccaggccctgccttacgtggctcttctgatagtgatgttg
ttcttcatctatgcggtgattgggatgcaggtgtttgggaagattgccctgaatgacacc
acagagatcaaccggaacaacaacttccagaccttcccccaagctgtgctgcttctcttc
aggtgtgccacaggggaggcatggcaggacatcatgctggcctgcatgccaggaaagaag
tgtgcccccgagtcggagcccagcaacagcacagaaggtgaaacaccctgtggcagcagc
ttcgcagtcttctacttcatcagcttctacatgctctgtgccttcctgatcattaacctc
tttgtagctgtcatcatggataactttgactacctgacaagggactggtcaattcttggt
ccccatcatctggatgaatttaaaagaatctgggcagagtatgatcctgaagccaagggt
cgaatcaaacacctagatgtagtgacactgctccggcggattcagcccccactgggtttt
gggaagctgtgccctcaccgtgtggcttgcaaacgtctagtctccatgaacatgcctctg
aacagtgatgggacggtcatgttcaatgccaccctgtttgccctggtccggacagccctg
aggatcaaaacagaagggaacctagaacaagccaacgaggagctgcgggccataatcaag
aagatctggaagcgaaccagcatgaaactgctggaccaagtggtgcctccagcgggtgat
gatgaggtcacggttggcaagttttatgctactttcctgatccaggagtacttccggaaa
ttcaagaagcgcaaagaacagggcctggtgggcaagccttcccagaggaacgccctatcc
ctgcaggctggcttgcgcacgctgcatgacattgggcctgagatccgacgggccatctct
ggagatctgacggctgaggaggagctggacaaggccatgaaggaggctgtgtctgctgcc
tctgaagacgacatcttcaggagggccggtggcctgttcggcaaccacgtcagctactac
caaagcgacggcaggagcgccttcccccagaccttcaccacccagcgcccactgcacatc
aataaggcggccaacagccaaggcgatgccgagtcaccatcccacgagaaactggtggac
tccactttcacccccagcagctactcgtccaccggctcgaatgccaacatcaacaatgcc
aacaacactggcctgggccgcttccccccgccttctggctaccctggcgctgccagcacc
gccgagggccacggaacccccctgtctcctgccggccgggtgcaggaggctgcatggaag
ctcagctccaagaggtgccactcccgggagagccagatagccatggtgtgtcaggaggag
gtctctcaggacgagacctatgacgtgaagatgagcgaagacgccgagtactgcagtgag
cccagcctgatctccacagagatgctgtcctatcaggatgatgaaaatcggcaattaaca
ccacctgaggaagacaagagggacgttcggcaatctccaaagaggggtttcctccgctct
gcctccctgggtcgaagggcctccttccacctggaatgtctgaagcggcagaagaatcaa
gcgggagatatctctcagaagacagtcctgcccttgcacctggttcatcaccaggcattg
gcagtggcaggcctgagccccctcctccagagaagccattcccctggcacgctccccagg
ccatgtgccacccccccagccacacccggcagccgaggctggcccccgcagcctatcccc
accctgcggctggagggggctgagtccaacgagaaactcaacagcagcttcccgtccatc
cactgcagctcctggtctgaggagcccacaccctgtggaggaggtgacagcaccatccgg
agagcccggccggtgtccctcactgtgcccagccaggctggggcccggggcaggcagttc
cacggcagtgccagcagcctcgtggaagcggtcttgatttcagaaggactggggcagttt
gctcaagatcccaagtttatcgaggtcacaacccaggagctggctgacgcctgtgacatg
accatagaggagatggagaacgccgctgacaacatcctcagtgggggcgcccagcagagc
cccaacggcaccctcctaccttttgttaactgcagggaccccgggcaggacaaagcgggg
ggtcacgtgggcgacgcctgcacggccgccctggcatgtcagaagagcgaggaagagctc
caggacagcagagcccacaccggcagcctgtag

DBGET integrated database retrieval system