KEGG   Canis familiaris (dog): 403544Help
Entry
403544            CDS       T01007                                 

Gene name
PTGS1
Definition
(RefSeq) prostaglandin G/H synthase 1 precursor
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00590  Arachidonic acid metabolism
cfa01100  Metabolic pathways
cfa04611  Platelet activation
cfa04726  Serotonergic synapse
cfa04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    403544 (PTGS1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    403544 (PTGS1)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    403544 (PTGS1)
  09156 Nervous system
   04726 Serotonergic synapse
    403544 (PTGS1)
Enzymes [BR:cfa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     403544 (PTGS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF hEGF EGF_2
Motif
Other DBs
NCBI-GeneID: 403544
NCBI-ProteinID: NP_001003023
Ensembl: ENSCAFG00000020263
VGNC: 45151
UniProt: Q8HZR1
LinkDB All DBs
Position
9
AA seq 633 aa AA seqDB search
MSREFDPEAPRNPLRLPGEPRMPGPALTSRSAGGSRLHRWPLLLLLLLLLPPPPVLPAEA
RTPAPVNPCCYYPCQHQGICVRFGLDRYQCDCTRTGYSGPNCTIPELWTWLRNSLRPSPS
FLHFLLTHGRWFWEFINATFIRDMLMRLVLTARSNLIPSPPTYNIAHDYISWESFSNVSY
YTRVLPSVPQDCPTPMGTKGKKQLPDAQLLGRRFLLRRKFIPDPQGTNLMFAFFAQHFTH
QFFKTSGKMGPGFTKALGHGVDLGHIYGDNLDRQYQLRLFKDGKLKYQVLDGEMYPPSVE
EAPVLMHYPRGILPQSQMAVGQEVFGLLPGLMLYATLWLREHNRVCDLLKAEHPTWGDEQ
LFQTARLILIGETIKIVIEEYVQQLSGYFLQLKFDPELLFSAQFQYRNRIAMEFNQLYHW
HPLMPDSFWVGSQEYSYEQFLFNTSMLTHYGIEALVDAFSRQSAGRIGGGRNIDHHVLHV
AVETIKESRELRLQPFNEYRKRFGMRPYMSFQELTGEKEMAAELEELYGDIDALEFYPGL
LLEKCHPNSIFGESMIEIGAPFSLKGLLGNPICSPEYWKPSTFGGEMGFNMVKTATLKKL
VCLNTKTCPYVSFRVPDPHQDGGPGVQRPSTEL
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgagccgtgagttcgaccctgaggcccccaggaaccctcttcgcctcccgggggagcct
cgaatgccaggcccagccctcacctctcgctccgcaggggggagtcgcctgcaccggtgg
ccgctgctcctgctgctgctgctgctgctcccgccgcccccggtcctgcccgcggaagcc
cggaccccggcgcctgtgaacccgtgttgttactacccatgtcagcaccaagggatctgt
gtccgcttcggccttgaccgctaccagtgtgactgcacccgcacgggctattctggcccc
aactgcaccatccccgagctgtggacctggctccggaattcactgcgccccagtccctct
ttcctccacttcctgctgacgcatgggcgctggttttgggaattcatcaatgccaccttc
atccgtgacatgctcatgcgtctggtactcacagcgcgttccaaccttatccccagtcct
cccacctacaacatagcgcatgactacatcagctgggagtccttctccaatgtgagctat
tacactcgtgttctgccctctgtgccccaagattgccccacgcccatggggaccaaaggg
aagaagcagttgccagacgcccaactcctgggccgtcgcttcctgctcaggaggaagttc
atacctgacccccaaggcaccaacctcatgttcgccttctttgcacaacacttcacccat
cagttcttcaaaacttctggcaagatgggtcctggcttcaccaaggccttgggccatggg
gtagatcttggccacatttatggggacaatctggaccgtcagtatcagctgcggctcttt
aaggatgggaaactcaagtatcaggttctggatggagagatgtacccgccatctgtggag
gaggcgcctgtgttgatgcactacccacggggcattctgccccagagtcagatggccgtg
ggccaggaggtgtttgggctgcttcctgggctcatgctctatgccacgctctggctgcgt
gagcacaatcgtgtgtgtgacctgctgaaggctgagcaccccacttggggtgatgagcaa
ctcttccagacggcccgactcatcctcattggggagaccatcaagattgtgattgaggag
tatgtgcagcagctgagtggctacttcttgcagctgaagttcgacccggagctgctgttt
agcgcccagttccagtaccgcaaccgcatcgccatggagttcaaccagctgtaccactgg
cacccgctcatgccagactccttctgggtgggttcccaggagtacagctatgagcagttc
ctgttcaacacctccatgctgacgcactacgggatcgaggccctggtggatgccttctct
cgccagagcgccggccggattggtggaggtagaaacatagaccaccatgtcctgcacgtg
gctgtggaaaccatcaaggaatcccgcgagttgcggctgcagcccttcaatgagtaccgc
aagaggtttggcatgaggccctacatgtccttccaggaactcacaggggagaaggagatg
gcagccgagttggaggagctgtatggagacattgatgccttggaattctacccggggctt
cttctggagaagtgccatccaaactccatctttggagagagtatgatagaaattggggct
cccttctcccttaagggcctcctagggaatcccatctgttctccagagtactggaagcca
agcacattcggtggtgagatgggcttcaatatggtcaagacagccacactgaagaagctg
gtctgccttaacaccaagacttgtccctatgtttccttccgtgtgcctgacccccaccag
gatggcgggcctggtgtgcagcggccgtccacagagctctga

DBGET integrated database retrieval system