KEGG   Canis lupus familiaris (dog): 403785
Entry
403785            CDS       T01007                                 

Gene name
IL4
Definition
(RefSeq) interleukin-4 precursor
  KO
K05430  interleukin 4
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa04060  Cytokine-cytokine receptor interaction
cfa04151  PI3K-Akt signaling pathway
cfa04630  JAK-STAT signaling pathway
cfa04640  Hematopoietic cell lineage
cfa04657  IL-17 signaling pathway
cfa04658  Th1 and Th2 cell differentiation
cfa04659  Th17 cell differentiation
cfa04660  T cell receptor signaling pathway
cfa04664  Fc epsilon RI signaling pathway
cfa04672  Intestinal immune network for IgA production
cfa05140  Leishmaniasis
cfa05200  Pathways in cancer
cfa05310  Asthma
cfa05320  Autoimmune thyroid disease
cfa05321  Inflammatory bowel disease
cfa05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    403785 (IL4)
   04151 PI3K-Akt signaling pathway
    403785 (IL4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    403785 (IL4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    403785 (IL4)
   04660 T cell receptor signaling pathway
    403785 (IL4)
   04658 Th1 and Th2 cell differentiation
    403785 (IL4)
   04659 Th17 cell differentiation
    403785 (IL4)
   04657 IL-17 signaling pathway
    403785 (IL4)
   04664 Fc epsilon RI signaling pathway
    403785 (IL4)
   04672 Intestinal immune network for IgA production
    403785 (IL4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    403785 (IL4)
  09163 Immune disease
   05310 Asthma
    403785 (IL4)
   05320 Autoimmune thyroid disease
    403785 (IL4)
   05321 Inflammatory bowel disease
    403785 (IL4)
   05330 Allograft rejection
    403785 (IL4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    403785 (IL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cfa04052]
    403785 (IL4)
   00536 Glycosaminoglycan binding proteins [BR:cfa00536]
    403785 (IL4)
Cytokines and growth factors [BR:cfa04052]
 Cytokines
  Interleukins
   403785 (IL4)
Glycosaminoglycan binding proteins [BR:cfa00536]
 Heparan sulfate / Haparin
  Cytokines
   403785 (IL4)
SSDB
Motif
Pfam: IL4 DUF5844 Ribosomal_S19e
Other DBs
NCBI-GeneID: 403785
NCBI-ProteinID: NP_001003159
Ensembl: ENSCAFG00000000880
VGNC: 41987
UniProt: O77762
LinkDB
Position
11
AA seq 132 aa
MGLTSQLIPTLVCLLALTSTFVHGHNFNITIKEIIKMLNILTARNDSCMELTVKDVFTAP
KNTSDKEIFCRAATVLRQIYTHNCSNRYLRGLYRNLSSMANKTCSMNEIKKSTLKDFLER
LKVIMQKKYYRH
NT seq 399 nt   +upstreamnt  +downstreamnt
atgggtctcacctcccaactgattccaactctggtctgcttactagcactcaccagcacc
tttgtccacggacataacttcaatattactattaaagagatcatcaaaatgttgaacatc
ctcacagcgagaaacgactcgtgcatggagctgactgtcaaggacgtcttcactgctcca
aagaacacaagcgataaggaaatcttctgcagagctgctactgtactgcggcagatctat
acacacaactgctccaacagatatctcagaggactctacaggaacctcagcagcatggca
aacaagacctgttctatgaatgaaatcaagaagagtacactgaaagacttcttggaaagg
ctaaaagtgatcatgcagaagaaatactacaggcattga

DBGET integrated database retrieval system