KEGG   Canis lupus familiaris (dog): 403822
Entry
403822            CDS       T01007                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase, inducible
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa00220  Arginine biosynthesis
cfa00330  Arginine and proline metabolism
cfa01100  Metabolic pathways
cfa04020  Calcium signaling pathway
cfa04066  HIF-1 signaling pathway
cfa04146  Peroxisome
cfa04371  Apelin signaling pathway
cfa04926  Relaxin signaling pathway
cfa05010  Alzheimer disease
cfa05014  Amyotrophic lateral sclerosis
cfa05022  Pathways of neurodegeneration - multiple diseases
cfa05133  Pertussis
cfa05140  Leishmaniasis
cfa05142  Chagas disease
cfa05145  Toxoplasmosis
cfa05146  Amoebiasis
cfa05152  Tuberculosis
cfa05200  Pathways in cancer
cfa05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    403822 (NOS2)
   00330 Arginine and proline metabolism
    403822 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    403822 (NOS2)
   04066 HIF-1 signaling pathway
    403822 (NOS2)
   04020 Calcium signaling pathway
    403822 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    403822 (NOS2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    403822 (NOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    403822 (NOS2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    403822 (NOS2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    403822 (NOS2)
   05014 Amyotrophic lateral sclerosis
    403822 (NOS2)
   05022 Pathways of neurodegeneration - multiple diseases
    403822 (NOS2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    403822 (NOS2)
   05152 Tuberculosis
    403822 (NOS2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    403822 (NOS2)
   05145 Toxoplasmosis
    403822 (NOS2)
   05140 Leishmaniasis
    403822 (NOS2)
   05142 Chagas disease
    403822 (NOS2)
Enzymes [BR:cfa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     403822 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 NAD_binding_6
Other DBs
NCBI-GeneID: 403822
NCBI-ProteinID: NP_001300777
Ensembl: ENSCAFG00000018642
VGNC: 43895
UniProt: O62699 F1PUQ2
LinkDB
Position
9
AA seq 1157 aa
MACPWQFLFKAKSYQYDLTEKTDINNNVGKASQAPSSLVTQDDPKCHSLSKHRDESPQSL
TGTVKTSPESTIKPAAPPLACPRHVRIKNWGNGMTFQDTLHHKAKGDLACKSKSCLGAIM
NPKSLTREPRDKPTPPDELLPQAIEFVNQYYSSFKEAKIEEHLARVEAVTKEIETTGTYQ
LTGDELIFATKQAWRNAPRCIGRIQWSNLQVFDARSCSTAKEMFEHICRHLRYASNNGNI
RSAITVFPQRTDGKHDFRVWNAQLIRYAGYQMPDGTILGDPASVEFTQLCIDLGWKPKYG
RFDVVPLVLQADGQDPEFFEIPPDLVLEVPMEHPKYEWFRELELKWYALPAVANMLLEVG
GLEFPGCPFNGWYMGTEIGVRDFCDVQRYNILEEVGRRMGLETHKLASLWKDRAVIEINV
AVLHSFQKQNVTIMDHHSAAESFMKYMQSEYRSRGGCPADWIWLVPPISGSITPVFHQEM
LNYVLSPFYYYQVEAWKTHVWQDEKRRPQRRKIQLKVLVKAVLFASMLMRKTMASRVRVT
ILFATETGKSETLARDLGALFSCAFHPKVLCMDEYKLSHLEEEQLLLVVTSTFGNGDSPG
NGEKLKKSLFMLKELTNKFRYAVFGLGSSMYPQFCAFAHDIDQKLSHLGASQLAPIGEGD
ELSGQEEAFRCWAVQTFKAACETFDVRGKHCIQIPRLYTSNVTWDPHQYRLVQDSQPLDL
NKALSRMHAKNVFTLRLKSQRNLQSPKSSRTTLLVELSCEDSQELSYLPGEHLGVFPGNQ
LALVQGILERVVDSPAPHQPVHLETLSERGSYWVRDKRLPPCSLSQALTYFLDITTPPTQ
LLLRKLAQLATEEAERQRLEILCQPSEYNKWKLTNSPTFLEVLEEFPSLRVSAGFLLSQL
PILKPRYYSISSSRDCTPMEVHLTVAVLVYPTRDGQGPLHHGVCSTWLSNLKPQDPVPCF
VRSAGNFKLPEDPSRPCILIGPGTGIAPFRSFWQQRLHDIKHKGLRGSRMTLVFGCRRPD
EDHLYREEMLEMAQSGVLHEVHTAYSRLPGQPKVYVQDILRQQLASQVLRMLHEEQGHLY
VCGDVRMARDVAHTLKHLVAAKLSLSEEQVEDYFFQLKSQKRYHEDIFGAVFPYEVKKDG
AAKQPSDPRVPAAHGRS
NT seq 3474 nt   +upstreamnt  +downstreamnt
atggcctgtccctggcagtttctgttcaaggccaaatcctaccagtacgacttgaccgag
aaaacagacattaacaacaacgtggggaaagccagccaggccccctccagtctagtgaca
caggatgaccccaagtgtcacagcctcagcaagcaccgggatgagtccccccagtccctc
acagggacagtaaagacgtctccagaatccacaatcaagccagctgcgcccccactggcc
tgcccacggcatgtgaggatcaaaaactggggcaacgggatgaccttccaagacacactt
caccacaaggccaaaggggatctcgcttgcaagtccaagtcttgtctgggagccatcatg
aaccccaaaagtttgaccagagaacccagggacaagccaacccccccagacgagcttcta
cctcaagccattgaatttgtcaaccagtattacagctccttcaaagaggcaaaaatagag
gaacatctggccagggtggaagcagtaacaaaggagatagaaacaacaggaacctatcag
ctgacgggggatgagctcatcttcgccaccaagcaggcctggcgcaacgctccccgctgc
atcgggaggatccagtggtccaacctccaggtctttgatgcccggagctgttccactgcc
aaggaaatgtttgagcacatctgcaggcacctgcgttatgccagcaacaatggcaacatc
aggtcggccatcaccgtgttcccccaacgaactgatgggaagcatgacttccgagtctgg
aacgcccagctcatccgctatgctggctaccagatgcccgatggcaccatcctgggggac
cctgccagtgtggagttcacccagctgtgcatcgacctgggctggaagcccaagtacggc
cgctttgatgtggtgcctctggtgctgcaggctgatggccaagaccctgagttcttcgaa
atcccacctgaccttgtgctcgaggtacccatggaacatcccaagtatgagtggttccgg
gagctggagctgaagtggtacgccctgcctgcagtggccaacatgctgcttgaggtgggt
ggccttgagttcccagggtgccccttcaacggctggtacatgggcacggagattggggtc
cgggacttctgtgatgttcagcgctacaacatcctggaggaagtgggcagaaggatgggc
ctggaaacacacaagctggcctcactctggaaggaccgggctgtcattgagatcaatgtc
gctgtactccacagtttccagaagcaaaatgtgaccatcatggatcaccactcagctgca
gagtccttcatgaagtacatgcagagcgagtaccgctcccgagggggctgccctgccgac
tggatttggctggtccccccaatttctgggagcatcactcctgtgttccaccaggagatg
ttaaattatgtcctgtcccctttctactactaccaggtggaggcctggaaaacccacgtg
tggcaggatgagaagcggagaccccagaggagaaagattcaacttaaagtcttggttaaa
gctgtgctttttgcctccatgctgatgcgcaagaccatggcatcccgagtcagagtcaca
atcctctttgcgacagagacgggaaagtcagaaacgctagcccgggacctaggggccttg
ttcagctgcgccttccaccccaaggttctctgcatggacgagtacaagctgagccacctg
gaggaggagcagctactgttggtggtgaccagcacgtttgggaacggagactcccctggc
aatggagagaaactaaaaaaatctctcttcatgctgaaagagcttaccaacaagttcagg
tatgccgtgtttggcctcggctccagcatgtaccctcagttctgtgcctttgctcatgac
atcgaccagaagctatcgcatctgggggcctctcagctcgccccaataggggaaggggat
gagctcagtggacaggaggaagccttccgctgctgggccgtgcaaaccttcaaggcagcc
tgtgagacgtttgatgtgcgaggcaaacactgcattcagatccccaggctctacacttcc
aatgtgacctgggacccacaccaatacaggctcgtgcaggactcgcagcctctggacctc
aacaaagccctcagcagaatgcatgccaagaacgtgttcaccctgaggctcaaatcacaa
cggaatctacagagtccaaaatccagccgcaccactctcctggtcgagctctcctgtgag
gacagccaggagctgagctacctgccaggagaacatctcggagttttcccaggcaaccag
ctggccctggtgcaaggcatcttggagcgagtagtagacagccctgcaccccaccagcct
gtgcacctggagaccctcagcgagaggggaagctactgggtcagagacaagcggctgcct
ccgtgctcactcagccaggccctcacctacttcctggacatcaccactcccccgacccag
ctgctgctccgaaagctggcacagctggccacagaagaggccgagaggcagaggttggag
atcctgtgccagccctcagaatacaacaagtggaagttaaccaacagtcccaccttcctg
gaggtgctggaggagttcccatccctgcgggtgtctgctggcttcctgctctcccagctc
cctattctgaaaccgcggtactactccatcagctcctccagggactgcacacccatggag
gtccacctcacggtggctgtgctcgtgtaccccacccgagatggccaaggtcctttgcac
catggtgtctgtagcacatggctcagcaacctgaagccccaagacccagtaccctgcttt
gtacgaagtgccggcaacttcaagctccccgaggatccctcccgtccttgcatcctcatt
ggacctggcacaggcatcgcccccttccgcagtttctggcagcagcggctccatgacatc
aagcacaaagggctccgaggcagccgcatgaccctggtgtttgggtgccgccgcccagat
gaggaccacctgtatcgggaggagatgttggagatggcccagagtggggtgctgcatgag
gtgcacacagcctattctcgcctgcctggccagcccaaggtctatgttcaagacatcctg
cggcagcagctggccagccaggtgctccgcatgctccatgaggagcagggccacctttat
gtctgtggggatgtgcgtatggcccgggatgtggcccataccctgaagcacctggtggct
gccaagctgagcctgagtgaagagcaagttgaggactattttttccagcttaagagccag
aagcgctatcatgaagatatctttggtgctgtgtttccctatgaggtgaaaaaagatggt
gcagcaaaacagcccagcgatcccagagttccagcagcccacggaagaagttaa

DBGET integrated database retrieval system