KEGG   Canis lupus familiaris (dog): 404002
Entry
404002            CDS       T01007                                 

Gene name
EPO
Definition
(RefSeq) erythropoietin precursor
  KO
K05437  erythropoietin
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa04060  Cytokine-cytokine receptor interaction
cfa04066  HIF-1 signaling pathway
cfa04151  PI3K-Akt signaling pathway
cfa04630  JAK-STAT signaling pathway
cfa04640  Hematopoietic cell lineage
cfa05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    404002 (EPO)
   04066 HIF-1 signaling pathway
    404002 (EPO)
   04151 PI3K-Akt signaling pathway
    404002 (EPO)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    404002 (EPO)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    404002 (EPO)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    404002 (EPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cfa04052]
    404002 (EPO)
Cytokines and growth factors [BR:cfa04052]
 Cytokines
  CSF and other factors
   404002 (EPO)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 404002
NCBI-ProteinID: NP_001006647
Ensembl: ENSCAFG00000014203
VGNC: 40422
UniProt: P33707
LinkDB
Position
6
AA seq 206 aa
MCEPAPPKPTQSAWHSFPECPALLLLLSLLLLPLGLPVLGAPPRLICDSRVLERYILEAR
EAENVTMGCAQGCSFSENITVPDTKVNFYTWKRMDVGQQALEVWQGLALLSEAILRGQAL
LANASQPSETPQLHVDKAVSSLRSLTSLLRALGAQKEAMSLPEEASPAPLRTFTVDTLCK
LFRIYSNFLRGKLTLYTGEACRRGDR
NT seq 621 nt   +upstreamnt  +downstreamnt
atgtgtgaacctgcccctccaaaacccacacagtcagcctggcactcttttccagaatgt
cctgccctgctccttttgctgtctttgctgctgcttcctctgggcctcccagtcctgggc
gccccccctcgcctcatttgtgacagccgggtcctggagagatacatcctggaggccagg
gaggccgaaaatgtcacgatgggctgtgctcaaggctgcagcttcagtgagaatatcacc
gtcccagacaccaaggttaatttctatacctggaagaggatggatgttgggcagcaggcc
ttggaagtctggcagggcctggcactgctctcagaagccatcctgcggggtcaggccctg
ttggccaacgcctcccagccatctgagactccgcagctgcatgtggacaaagccgtcagc
agcctgcgcagcctcacctctctgcttcgggcgctgggagcccagaaggaggccatgtcc
cttccagaggaagcctctcctgctccactccgaacattcactgttgatactttgtgcaaa
cttttccgaatctactccaatttcctccgtggaaagctgacactgtacacaggggaggcc
tgcagaagaggagacaggtga

DBGET integrated database retrieval system