KEGG   Canis lupus familiaris (dog): 442860
Entry
442860            CDS       T01007                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet-derived growth factor receptor alpha isoform X2
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa01521  EGFR tyrosine kinase inhibitor resistance
cfa04010  MAPK signaling pathway
cfa04014  Ras signaling pathway
cfa04015  Rap1 signaling pathway
cfa04020  Calcium signaling pathway
cfa04072  Phospholipase D signaling pathway
cfa04144  Endocytosis
cfa04151  PI3K-Akt signaling pathway
cfa04510  Focal adhesion
cfa04540  Gap junction
cfa04630  JAK-STAT signaling pathway
cfa04810  Regulation of actin cytoskeleton
cfa05163  Human cytomegalovirus infection
cfa05200  Pathways in cancer
cfa05206  MicroRNAs in cancer
cfa05214  Glioma
cfa05215  Prostate cancer
cfa05218  Melanoma
cfa05230  Central carbon metabolism in cancer
cfa05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    442860 (PDGFRA)
   04014 Ras signaling pathway
    442860 (PDGFRA)
   04015 Rap1 signaling pathway
    442860 (PDGFRA)
   04630 JAK-STAT signaling pathway
    442860 (PDGFRA)
   04020 Calcium signaling pathway
    442860 (PDGFRA)
   04072 Phospholipase D signaling pathway
    442860 (PDGFRA)
   04151 PI3K-Akt signaling pathway
    442860 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    442860 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    442860 (PDGFRA)
   04540 Gap junction
    442860 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    442860 (PDGFRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    442860 (PDGFRA)
   05206 MicroRNAs in cancer
    442860 (PDGFRA)
   05230 Central carbon metabolism in cancer
    442860 (PDGFRA)
   05231 Choline metabolism in cancer
    442860 (PDGFRA)
  09162 Cancer: specific types
   05214 Glioma
    442860 (PDGFRA)
   05218 Melanoma
    442860 (PDGFRA)
   05215 Prostate cancer
    442860 (PDGFRA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    442860 (PDGFRA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    442860 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cfa01001]
    442860 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:cfa04090]
    442860 (PDGFRA)
Enzymes [BR:cfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     442860 (PDGFRA)
Protein kinases [BR:cfa01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   442860 (PDGFRA)
CD molecules [BR:cfa04090]
 Proteins
  442860 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set Herpes_gE C2-set_2 LAT Kinase-like
Other DBs
NCBI-GeneID: 442860
NCBI-ProteinID: XP_005628252
Ensembl: ENSCAFG00000002057
VGNC: 44372
UniProt: F1PUX6
LinkDB
Position
13
AA seq 1114 aa
MLPMDERHFWGGSQSLLGDRKFSGTMGTSLLALLILGCLLAGPSLILCQLSLPSILPNEN
EKVVQLNSSFSLRCFGESEVSWHYPTSEEENPNVEIRNEENNSGLFVTVLEVVNASAAHT
GLYTCYYNHTQTDENEIEGRHIYIYVPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDP
ETPVTLLSNDGVVHASYDSRQGFNGTFSVGPYICEATVRGKKFQTIPFNVYALKATSELD
LEMEALKTVYKSGETIVVTCAVFNNEVVDLQWTYPGEVKGKGITMLEEIKVPSIKLVYTL
RVPEATVKDSGDYECAARQATKEVKEMKKVTISVHEKGFIEIKPNFSQLEAVDLHEVKHF
VVDVQAYPPPRISWLKDNLTLIENLTEITTDIERTQEIRYRSKLKLIRAKEEDSGHYTIV
VQNEDDVKSYTFELLTQVPSSILDLVDDHHGSTGGQTVRCIAEGTPLPDIEWMICKDIKK
CNNETSWAILANNISNIITEVHPRDRSTVEGRVTFTRVEETIAVRCLAKNLLGAESRELK
LVAPTLRSELTVAAAVLVLLVIVIISLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYV
DPMQLPYDSRWEFPRDGLVLGRILGSGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARS
SEKQALMSELKIMTHLGPHLNIVNLLGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLS
RHPEKPKKELDIFGLNPADDSTRSYVILSFENNGDYMDMKQADTTQYVPMLERKEVSKYS
DIQRSLYDRPASYKKKSMLDSEVKNLLSDDNSEGLTLLDLLSFTYQVARGMEFLASKNCV
HRDLAARNVLLAQGKIVKICDFGLARDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTL
SDVWSYGILLWEIFSLGGTPYPGMMVDSTFYNKIKSGYRMAKPDHATSEVYEIMVKCWHS
EPEKRPSFYHLSEIVENLLPGQYKKSYEKIHLDFLKSDHPAVARMRVDSDNAYIGVTYKN
EEDKLKDWEGSLDEQRLSADSGYIIPLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSS
SSTFIKREDETIEDIDMMDDIGIDSSDLVEDSFL
NT seq 3345 nt   +upstreamnt  +downstreamnt
atgttgccgatggacgagcggcacttctggggggggagccaaagcctgctcggggaccga
aagttttccggaactatggggacttcccttctggcactcctgatcttaggctgtctcctc
gcagggcccagcctaatcctctgccagctttcattaccctcgatccttccaaatgaaaat
gaaaaggtcgtgcagctgaattcatccttttctctgagatgctttggggagagtgaagtg
agttggcattaccccacgtctgaagaagagaaccccaatgtggagatcagaaatgaggag
aacaacagtggcctttttgtgaccgtgttggaagtggtcaacgcgtcggcggcgcacacg
gggctgtacacttgctattacaaccacactcagacagacgaaaacgagatcgaaggcagg
cacatctacatctatgtgccagacccggatgtcgccttcgtacctctaggaatgacagat
tatttagtcatcgtggaggatgatgactctgccatcataccttgtcgtacaactgatcct
gagactccggtcaccttactcagcaatgatggggtggtacatgcgtcctatgacagcaga
cagggctttaatgggaccttcagcgttgggccgtatatctgcgaagccactgtcaggggc
aagaagttccagaccatcccatttaatgtttatgctttaaaagcaacgtcagaacttgat
ctagaaatggaagctcttaaaactgtgtataagtcaggggagacgattgtggtcacctgc
gccgtctttaacaacgaggtggtggaccttcaatggacctaccctggagaggtgaaaggc
aaaggcatcaccatgttggaggaaataaaggtcccgtccatcaaattggtgtacactctg
agggtccccgaggccacggtgaaagatagtggagattatgaatgtgctgcccgccaggcc
accaaggaagtcaaagagatgaagaaagtcaccatttctgtccatgagaaagggttcatt
gaaatcaaacccaacttcagccagttggaagctgttgacctacacgaagtcaagcatttc
gtggtggacgtgcaggcctacccacctcccaggatatcctggctgaaggacaacctgact
ctgattgaaaatctcacagagatcaccactgacatagaaaggactcaggaaataaggtat
cgaagcaaattaaagctgatccgtgctaaggaggaggacagtggccattacactatcgtc
gttcaaaatgaggatgacgtcaagagctatactttcgaactcttaactcaagttccctcg
tctattctggacttggtcgatgaccaccacggctctactgggggacagaccgtgagatgc
atcgctgaagggacacctcttcctgatattgaatggatgatttgcaaggatattaagaaa
tgtaataatgaaacctcctgggcgattttggccaacaatatctcaaacattatcacggag
gtccacccccgagacaggagtactgtggagggccgggtgaccttcaccagagtggaggag
accatcgccgttcgatgtctggccaagaatctccttggggccgagagccgagagctgaag
ctggtggctcccacgctgcgttctgagctcacggtggcagctgcagtcctggtgctattg
gtgattgtgatcatctcacttatcgtcctggttgtcatttggaaacagaaaccgaggtat
gaaattcgttggagggtcattgaatccatcagccctgatggacatgaatatatttacgtg
gacccgatgcagctgccttatgactcaagatgggagtttccaagagatggacttgtgctt
ggtcggatcctgggatctggtgcgtttgggaaagtggttgaaggaactgcctatggatta
agccgctcccagccggtcatgaaagtcgcagtgaagatgctgaaacccacagccagatcc
agtgaaaaacaagctctcatgtcggaactgaagataatgactcacctggggccgcattta
aacattgtgaacttgctgggagcctgtaccaagtcaggccccatttacatcatcaccgag
tactgcttctatggggatttggtcaactatttgcataagaatagagatagcttcctgagc
cgccacccggagaagccaaagaaagagttggacatttttggattgaaccctgctgatgac
agcacacggagttacgttattttgtcttttgaaaacaacggtgactacatggacatgaag
caagctgacaccacacagtatgtccccatgctggaaaggaaagaggtttctaagtactcg
gacatccagagatcgctgtatgatcgtccagcctcgtacaagaagaaatctatgttagac
tccgaagtcaaaaacctcctttcggatgataactcagaaggccttactttgttggatttg
ttgagcttcacctatcaagttgcgcgaggaatggagtttttggcttcgaaaaattgtgtc
caccgggacctggctgctcgaaacgtcctcctggcacaagggaaaatcgtgaagatctgc
gacttcggcctggccagagacatcatgcacgattcaaactatgtgtctaaaggcagtacc
tttctccccgtgaagtggatggctcccgagagcatcttcgacaacctctacaccacgctg
agtgacgtctggtcctacggcatcctgctctgggagatcttttcccttggcggcacaccc
taccctggcatgatggtggattctactttctacaataagatcaagagtggataccggatg
gccaagcctgaccacgccaccagtgaagtctatgagatcatggtgaagtgctggcacagt
gaaccggagaagagaccctccttttaccacctgagcgagatcgtggagaatctgctgcct
ggacaatataagaagagttacgagaagattcacctggacttcctgaagagcgaccacccc
gccgtggcgcgtatgcgcgtggactcagacaacgcctacatcggcgtcacctacaaaaac
gaggaggacaagctgaaggactgggagggcagcctggacgagcagaggctgagcgccgac
agcggctacatcatccccctgcccgacatcgacccggtgcccgaggaggaagacctgggc
aagaggaacagacacagctcgcagacctcagaagaaagcgctatcgagacaggttccagc
agctctaccttcatcaagagagaggacgaaaccatcgaggacatcgacatgatggacgac
attggaatagactcctcagacctggtagaggacagcttcctgtga

DBGET integrated database retrieval system