KEGG   Canis familiaris (dog): 442942Help
Entry
442942            CDS       T01007                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin G/H synthase 2 precursor
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00590  Arachidonic acid metabolism
cfa01100  Metabolic pathways
cfa04064  NF-kappa B signaling pathway
cfa04370  VEGF signaling pathway
cfa04625  C-type lectin receptor signaling pathway
cfa04657  IL-17 signaling pathway
cfa04668  TNF signaling pathway
cfa04723  Retrograde endocannabinoid signaling
cfa04726  Serotonergic synapse
cfa04913  Ovarian steroidogenesis
cfa04921  Oxytocin signaling pathway
cfa04923  Regulation of lipolysis in adipocytes
cfa05140  Leishmaniasis
cfa05163  Human cytomegalovirus infection
cfa05165  Human papillomavirus infection
cfa05167  Kaposi sarcoma-associated herpesvirus infection
cfa05200  Pathways in cancer
cfa05204  Chemical carcinogenesis
cfa05206  MicroRNAs in cancer
cfa05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    442942 (PTGS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    442942 (PTGS2)
   04064 NF-kappa B signaling pathway
    442942 (PTGS2)
   04668 TNF signaling pathway
    442942 (PTGS2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    442942 (PTGS2)
   04657 IL-17 signaling pathway
    442942 (PTGS2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    442942 (PTGS2)
   04913 Ovarian steroidogenesis
    442942 (PTGS2)
   04921 Oxytocin signaling pathway
    442942 (PTGS2)
  09156 Nervous system
   04726 Serotonergic synapse
    442942 (PTGS2)
   04723 Retrograde endocannabinoid signaling
    442942 (PTGS2)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    442942 (PTGS2)
   05206 MicroRNAs in cancer
    442942 (PTGS2)
   05204 Chemical carcinogenesis
    442942 (PTGS2)
  09162 Cancers: Specific types
   05222 Small cell lung cancer
    442942 (PTGS2)
  09172 Infectious diseases: Viral
   05163 Human cytomegalovirus infection
    442942 (PTGS2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    442942 (PTGS2)
   05165 Human papillomavirus infection
    442942 (PTGS2)
  09174 Infectious diseases: Parasitic
   05140 Leishmaniasis
    442942 (PTGS2)
Enzymes [BR:cfa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     442942 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF hEGF
Motif
Other DBs
NCBI-GeneID: 442942
NCBI-ProteinID: NP_001003354
Ensembl: ENSCAFG00000013762
VGNC: 45152
UniProt: Q8SPQ9
LinkDB All DBs
Position
7
AA seq 604 aa AA seqDB search
MLARALVLCAALAVVRAANPCCSHPCQNQGICMSTGFDQYKCDCTRTGFYGENCSTPEFL
TRIKLYLKPTPNTVHYILTHFKGVWNIVNNIPFLRNTIMKYVLTSRSHLIESPPTYNVNY
GYKSWEAFSNLSYYTRALPPVPDDCPTPMGVKGKKELPDSKEIVEKFLLRRKFIPDPQGT
NMMFAFFAQHFTHQFFKTDHKRGPAFTKGLGHGVDLNHVYGETLDRQHKLRLFKDGKMKY
QVIDGEVYPPTVKDTQVEMIYPPHVPEHLQFAVGQEVFGLVPGLMMYATIWLREHNRVCD
VLKQEHPEWDDERLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQFQYQ
NRIAAEFNTLYHWHPLLPDTLQIDDQEYNFQQFIYNNSILLEHGLTQFVESFSRQIAGRV
AGGRNVPAAVQQVAKASIDQSRQMKYQSLNEYRKRFRLKPYTSFEELTGEKEMAAGLEAL
YGDIDAMELYPALLVEKPRPDAIFGETMVEMGAPFSLKGLMGNPICSPDYWKPSTFGGEV
GFKIINTASIQSLICNNVKGCPFTAFSVQDGQLTKTVTINASSSHSGLDDINPTVLLKER
STEL
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgctggcccgcgccctggtgctctgcgccgccctggcggtcgtccgcgcagcaaatcct
tgctgttcccacccatgtcaaaaccaaggtatttgtatgagcacaggatttgaccagtat
aagtgtgactgtacccgaacaggattctacggcgaaaactgctcaacaccggaatttctg
acaagaataaaattatacctgaaacccactccaaatacagtacactacatacttacccac
ttcaagggagtctggaacattgtcaataacatccccttcctgcgaaatacaattatgaaa
tatgtgttgacatcccggtcacatttgattgagagtccaccaacttataatgtgaactac
ggctataaaagctgggaagccttttctaacctctcctattataccagagctcttccccct
gtacctgatgactgtccaacacccatgggtgtgaaaggcaagaaagagcttcctgattca
aaagagattgtggaaaagtttcttctgcgaagaaagttcattcctgatccccaaggcacc
aatatgatgtttgcattctttgcccagcactttacccatcaatttttcaagacagatcat
aagcgaggaccagctttcaccaaaggattgggccatggggtggacttaaatcatgtttat
ggggaaactttggatagacaacataaactgcgccttttcaaggatggaaaaatgaaatat
caggtaattgatggagaggtgtatcctcctaccgtcaaagatactcaggtcgagatgatc
tacccacctcatgttcctgaacacctgcagtttgctgtgggccaggaggtctttggtctg
gtgcctggtctgatgatgtatgccaccatttggctgcgggagcataacagagtgtgtgat
gtgcttaaacaggagcacccagaatgggatgatgagcggttattccagacgagcaggcta
atacttataggagaaaccattaagattgtgattgaagactatgtacaacacttgagtggc
tatcacttcaagctgaagtttgacccagagctgcttttcaaccaacaattccagtaccaa
aaccgcattgctgctgagtttaacacactctaccactggcatcccctcctgcctgacacc
ttgcaaatagatgaccaggagtacaatttccaacagtttatctacaacaactctatatta
ttggaacatggccttacccagtttgtggaatcattcagcaggcaaattgctggcagggtt
gccggtggcaggaatgttccagctgcagtacaacaagtagcaaaagcttcgattgaccag
agcagacagatgaaataccagtctcttaatgagtatcgcaaacgctttaggctgaagccc
tatacatcattcgaagaacttacaggagagaaggaaatggctgcggggttggaggccctt
tatggtgatattgatgccatggagctgtatcctgccctcttggtagaaaagcctcgtcca
gatgccatctttggtgagaccatggtagaaatgggagcaccattctccttgaaaggactt
atgggtaatcccatctgttcacctgactactggaagcctagcacctttggtggagaagta
ggctttaaaatcatcaacactgcctcaatccagtctctcatctgcaataacgtgaagggc
tgtccattcactgcattctctgttcaagacggacaactcaccaaaacagtcaccattaat
gcaagctcttcgcactccggtctagatgacatcaatcccacagtcctactgaaagaacgg
tcaactgaactatag

DBGET integrated database retrieval system