KEGG   Canis lupus familiaris (dog): 449028
Entry
449028            CDS       T01007                                 

Gene name
CCND1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa01522  Endocrine resistance
cfa04068  FoxO signaling pathway
cfa04110  Cell cycle
cfa04115  p53 signaling pathway
cfa04151  PI3K-Akt signaling pathway
cfa04152  AMPK signaling pathway
cfa04218  Cellular senescence
cfa04310  Wnt signaling pathway
cfa04340  Hedgehog signaling pathway
cfa04371  Apelin signaling pathway
cfa04390  Hippo signaling pathway
cfa04510  Focal adhesion
cfa04530  Tight junction
cfa04630  JAK-STAT signaling pathway
cfa04917  Prolactin signaling pathway
cfa04919  Thyroid hormone signaling pathway
cfa04921  Oxytocin signaling pathway
cfa04933  AGE-RAGE signaling pathway in diabetic complications
cfa04934  Cushing syndrome
cfa05160  Hepatitis C
cfa05162  Measles
cfa05163  Human cytomegalovirus infection
cfa05165  Human papillomavirus infection
cfa05166  Human T-cell leukemia virus 1 infection
cfa05167  Kaposi sarcoma-associated herpesvirus infection
cfa05169  Epstein-Barr virus infection
cfa05200  Pathways in cancer
cfa05203  Viral carcinogenesis
cfa05205  Proteoglycans in cancer
cfa05206  MicroRNAs in cancer
cfa05210  Colorectal cancer
cfa05212  Pancreatic cancer
cfa05213  Endometrial cancer
cfa05214  Glioma
cfa05215  Prostate cancer
cfa05216  Thyroid cancer
cfa05218  Melanoma
cfa05219  Bladder cancer
cfa05220  Chronic myeloid leukemia
cfa05221  Acute myeloid leukemia
cfa05222  Small cell lung cancer
cfa05223  Non-small cell lung cancer
cfa05224  Breast cancer
cfa05225  Hepatocellular carcinoma
cfa05226  Gastric cancer
cfa05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    449028 (CCND1)
   04340 Hedgehog signaling pathway
    449028 (CCND1)
   04390 Hippo signaling pathway
    449028 (CCND1)
   04371 Apelin signaling pathway
    449028 (CCND1)
   04630 JAK-STAT signaling pathway
    449028 (CCND1)
   04068 FoxO signaling pathway
    449028 (CCND1)
   04151 PI3K-Akt signaling pathway
    449028 (CCND1)
   04152 AMPK signaling pathway
    449028 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    449028 (CCND1)
   04115 p53 signaling pathway
    449028 (CCND1)
   04218 Cellular senescence
    449028 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    449028 (CCND1)
   04530 Tight junction
    449028 (CCND1)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    449028 (CCND1)
   04921 Oxytocin signaling pathway
    449028 (CCND1)
   04919 Thyroid hormone signaling pathway
    449028 (CCND1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    449028 (CCND1)
   05206 MicroRNAs in cancer
    449028 (CCND1)
   05205 Proteoglycans in cancer
    449028 (CCND1)
   05203 Viral carcinogenesis
    449028 (CCND1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    449028 (CCND1)
   05212 Pancreatic cancer
    449028 (CCND1)
   05225 Hepatocellular carcinoma
    449028 (CCND1)
   05226 Gastric cancer
    449028 (CCND1)
   05214 Glioma
    449028 (CCND1)
   05216 Thyroid cancer
    449028 (CCND1)
   05221 Acute myeloid leukemia
    449028 (CCND1)
   05220 Chronic myeloid leukemia
    449028 (CCND1)
   05218 Melanoma
    449028 (CCND1)
   05219 Bladder cancer
    449028 (CCND1)
   05215 Prostate cancer
    449028 (CCND1)
   05213 Endometrial cancer
    449028 (CCND1)
   05224 Breast cancer
    449028 (CCND1)
   05222 Small cell lung cancer
    449028 (CCND1)
   05223 Non-small cell lung cancer
    449028 (CCND1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    449028 (CCND1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    449028 (CCND1)
   04934 Cushing syndrome
    449028 (CCND1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    449028 (CCND1)
   05162 Measles
    449028 (CCND1)
   05160 Hepatitis C
    449028 (CCND1)
   05163 Human cytomegalovirus infection
    449028 (CCND1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    449028 (CCND1)
   05169 Epstein-Barr virus infection
    449028 (CCND1)
   05165 Human papillomavirus infection
    449028 (CCND1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    449028 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 449028
NCBI-ProteinID: NP_001005757
UniProt: Q64HP0
LinkDB
Position
18
AA seq 295 aa
MAHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEILPSMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLNRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPDELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPVAEENKQIIRK
HAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLHLGSSNSFLSYHRLTRFLSKVIKCD
ADCLRACQEQIEALLESSLRQAQQQSLDPKAAEEEEEEEEADLACTPTDVRDVNI
NT seq 888 nt   +upstreamnt  +downstreamnt
atggcacaccagctcctgtgctgcgaggtggagaccatccgccgggcgtaccccgatgcc
aacctgctcaacgaccgggtgctgcgggccatgcttaaggcggaggagacttgcgcgccg
tccgtgtcctacttcaagtgtgtgcagaaggagatcctgccgtccatgcggaagatcgtg
gccacctggatgctagaggtctgcgaggagcagaagtgcgaggaggaggtcttcccgctg
gccatgaactacctgaaccgcttcctgtcgctggagcccgtgaaaaagagccgcctgcag
ctgctgggggccacctgcatgttcgtggcctcgaagatgaaggagaccatcccgctgacg
gccgagaagctgtgcatctacactgacaactccatccggcccgacgaactgctgcaaatg
gagctgctcctggtgaacaaactgaagtggaacctggcagccatgaccccacacgacttc
atcgagcacttcctctccaagatgccagtggcagaggagaacaaacagatcatccgcaag
cacgcgcagaccttcgtagcgctctgtgccacagatgtgaagttcatttccaacccaccc
tccatggtggcagctggcagtgtggtggccgccgtgcaaggtctacacctgggaagttcc
aacagcttcctgtcctaccaccgcctcactcggttcctctccaaagtgattaagtgtgat
gcggactgtctccgggcgtgccaggagcagatcgaagccctgctggagtccagcctgcgc
caggcccagcagcagagcctggaccccaaggcggcggaggaggaggaggaggaggaggag
gccgacctggcctgcacgcccaccgatgtgcgagacgtgaacatttga

DBGET integrated database retrieval system