KEGG   Canis familiaris (dog): 474469Help
Entry
474469            CDS       T01007                                 

Gene name
RIBC2
Definition
(RefSeq) RIB43A-like with coiled-coils protein 2
Organism
cfa  Canis familiaris (dog)
SSDB OrthologParalogGFIT
Motif
Pfam: RIB43A
Motif
Other DBs
NCBI-GeneID: 474469
NCBI-ProteinID: XP_531699
Ensembl: ENSCAFG00000000809
VGNC: 45569
UniProt: F1PLV3
LinkDB All DBs
Position
10
AA seq 377 aa AA seqDB search
MELAQPRDLGQDLALGKRRHNELCRQKRVFNARNRIVGGDTEAWDIQVRDQKIKEATEKA
RHETFAAEMRHNDKITCILEGRERRDKRSLCKAINDFQQSFQRPETRREFDLSDPLALKK
DLPARQSDNDIRNTISGMQKFMGEDLNFRERKKFQEEQNREWSLQQQREWEDARAHQRCA
EDLYLKTRLQFDETAKHLQNLESATRKAVCVAVKEFNKSQATESLERKIQEKKQEQEDNV
AEISNLLHGDLLSENPQQAASSFGPHRVVPDRWKGMTQEQLEQIRLVQKQQIQEKLRLQE
EERQRDMDWDRRRVQMARAVLLLERQQRRQQRDLRRALDCNNLSLAKEQRLQKKHMEEIC
TNEPTEDYFTQFNTRSR
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggagctagcgcagcccagggacctggggcaggacttggctctgggtaaaaggaggcac
aacgagctgtgcaggcagaaacgggtcttcaacgccaggaaccggatcgtggggggagac
acagaagcctgggatattcaggttcgagaccagaagataaaagaagcaacagaaaaagct
agacatgaaacttttgccgctgaaatgaggcataatgacaaaatcacatgcatattggaa
ggccgggaaaggagagataagagaagcctctgtaaagccatcaatgacttccagcagagc
ttccagaggccagaaacgcgccgtgaatttgacctatctgaccccctagcccttaagaaa
gatcttccagcgagacagtcagataatgatattcggaataccatatcgggaatgcagaaa
ttcatgggagaggatttaaatttccgggagaggaagaaattccaggaggaacaaaaccga
gagtggtccttgcaacagcaaagggaatgggaggatgcccgtgcccaccagagatgtgca
gaggacctgtacttgaagacaaggctgcagtttgatgaaacagccaagcatctacagaat
ctggagagcgccaccagaaaggcggtttgtgtagctgtgaaagaattcaacaagagccag
gccaccgaatcactggaaaggaaaattcaagagaaaaaacaggaacaagaagacaacgtg
gctgagatctccaacctgctgcacggggacctgctctcggagaacccacagcaggcagcc
agctcctttgggccccaccgtgtggtgccagaccgctggaagggcatgacccaggagcaa
ctggagcagatccgcctggttcagaagcagcaaatccaggagaagctgaggcttcaagaa
gaagagcggcagcgagatatggactgggaccgccggcgggtgcagatggctcgagccgtt
ctcctcctggagcggcagcagcggcgccagcagcgtgacctgcgcagggccctggactgc
aacaacctcagcctggccaaggagcagcgtttgcagaaaaaacatatggaggaaatctgt
acaaatgaacccactgaagactatttcacgcaatttaatacaagaagtcggtaa

DBGET integrated database retrieval system