KEGG   Canis lupus familiaris (dog): 474890
Entry
474890            CDS       T01007                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa01522  Endocrine resistance
cfa01524  Platinum drug resistance
cfa04012  ErbB signaling pathway
cfa04066  HIF-1 signaling pathway
cfa04068  FoxO signaling pathway
cfa04110  Cell cycle
cfa04115  p53 signaling pathway
cfa04151  PI3K-Akt signaling pathway
cfa04218  Cellular senescence
cfa04630  JAK-STAT signaling pathway
cfa04921  Oxytocin signaling pathway
cfa04928  Parathyroid hormone synthesis, secretion and action
cfa04934  Cushing syndrome
cfa05160  Hepatitis C
cfa05161  Hepatitis B
cfa05163  Human cytomegalovirus infection
cfa05165  Human papillomavirus infection
cfa05166  Human T-cell leukemia virus 1 infection
cfa05167  Kaposi sarcoma-associated herpesvirus infection
cfa05169  Epstein-Barr virus infection
cfa05200  Pathways in cancer
cfa05202  Transcriptional misregulation in cancer
cfa05203  Viral carcinogenesis
cfa05205  Proteoglycans in cancer
cfa05206  MicroRNAs in cancer
cfa05210  Colorectal cancer
cfa05211  Renal cell carcinoma
cfa05212  Pancreatic cancer
cfa05213  Endometrial cancer
cfa05214  Glioma
cfa05215  Prostate cancer
cfa05216  Thyroid cancer
cfa05217  Basal cell carcinoma
cfa05218  Melanoma
cfa05219  Bladder cancer
cfa05220  Chronic myeloid leukemia
cfa05222  Small cell lung cancer
cfa05223  Non-small cell lung cancer
cfa05224  Breast cancer
cfa05225  Hepatocellular carcinoma
cfa05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    474890 (CDKN1A)
   04630 JAK-STAT signaling pathway
    474890 (CDKN1A)
   04066 HIF-1 signaling pathway
    474890 (CDKN1A)
   04068 FoxO signaling pathway
    474890 (CDKN1A)
   04151 PI3K-Akt signaling pathway
    474890 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    474890 (CDKN1A)
   04115 p53 signaling pathway
    474890 (CDKN1A)
   04218 Cellular senescence
    474890 (CDKN1A)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    474890 (CDKN1A)
   04928 Parathyroid hormone synthesis, secretion and action
    474890 (CDKN1A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    474890 (CDKN1A)
   05202 Transcriptional misregulation in cancer
    474890 (CDKN1A)
   05206 MicroRNAs in cancer
    474890 (CDKN1A)
   05205 Proteoglycans in cancer
    474890 (CDKN1A)
   05203 Viral carcinogenesis
    474890 (CDKN1A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    474890 (CDKN1A)
   05212 Pancreatic cancer
    474890 (CDKN1A)
   05225 Hepatocellular carcinoma
    474890 (CDKN1A)
   05226 Gastric cancer
    474890 (CDKN1A)
   05214 Glioma
    474890 (CDKN1A)
   05216 Thyroid cancer
    474890 (CDKN1A)
   05220 Chronic myeloid leukemia
    474890 (CDKN1A)
   05217 Basal cell carcinoma
    474890 (CDKN1A)
   05218 Melanoma
    474890 (CDKN1A)
   05211 Renal cell carcinoma
    474890 (CDKN1A)
   05219 Bladder cancer
    474890 (CDKN1A)
   05215 Prostate cancer
    474890 (CDKN1A)
   05213 Endometrial cancer
    474890 (CDKN1A)
   05224 Breast cancer
    474890 (CDKN1A)
   05222 Small cell lung cancer
    474890 (CDKN1A)
   05223 Non-small cell lung cancer
    474890 (CDKN1A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    474890 (CDKN1A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    474890 (CDKN1A)
   05161 Hepatitis B
    474890 (CDKN1A)
   05160 Hepatitis C
    474890 (CDKN1A)
   05163 Human cytomegalovirus infection
    474890 (CDKN1A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    474890 (CDKN1A)
   05169 Epstein-Barr virus infection
    474890 (CDKN1A)
   05165 Human papillomavirus infection
    474890 (CDKN1A)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    474890 (CDKN1A)
   01522 Endocrine resistance
    474890 (CDKN1A)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 474890
NCBI-ProteinID: XP_005627336
Ensembl: ENSCAFG00000029853
VGNC: 39068
LinkDB
Position
12
AA seq 164 aa
MSEPSRDALPIPHGSKACRRLFGPVDSEQLRRDCDALMASCVQEARERWNFDFVTETPLE
GDFAWERVRGLGLSKVSLPAGPRGGRDDLGGGKRPGTSPALLQGTAQEDHLDLSLTCTLL
PHSPERPEASPGVPGTSQGRKRRQTSMTDFYHSKRRLIFSKRKP
NT seq 495 nt   +upstreamnt  +downstreamnt
atgtcggagccgtccagggacgccctgcccatccctcatggcagcaaggcttgccgccgc
ctcttcggccccgtggacagcgagcagctgcgccgggactgtgacgcgctgatggccagc
tgtgtgcaagaggcccgggagcgatggaactttgacttcgtcaccgagacgccgctggaa
ggcgactttgcctgggagcgcgtgcggggcctgggcctgtccaaggtctccctgcctgcg
gggccccgggggggccgggatgacctgggagggggcaagcggcccggcacctcgcctgcc
ctgctgcaggggacagctcaggaggaccacctggacctgtcgctgacctgcaccctcctg
cctcactcccctgagcggcctgaggcatccccgggtgtgcctggcacctctcagggccga
aaacggcggcagaccagcatgacagatttctatcactccaaacgccggctgatcttctcc
aagaggaagccctaa

DBGET integrated database retrieval system