KEGG   Canis familiaris (dog): 475035Help
Entry
475035            CDS       T01007                                 

Gene name
HDAC2
Definition
(RefSeq) histone deacetylase 2 isoform X1
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04110  Cell cycle
cfa04213  Longevity regulating pathway - multiple species
cfa04330  Notch signaling pathway
cfa04919  Thyroid hormone signaling pathway
cfa05016  Huntington disease
cfa05034  Alcoholism
cfa05165  Human papillomavirus infection
cfa05169  Epstein-Barr virus infection
cfa05200  Pathways in cancer
cfa05202  Transcriptional misregulation in cancer
cfa05203  Viral carcinogenesis
cfa05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    475035 (HDAC2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    475035 (HDAC2)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    475035 (HDAC2)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    475035 (HDAC2)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    475035 (HDAC2)
   05202 Transcriptional misregulation in cancers
    475035 (HDAC2)
   05203 Viral carcinogenesis
    475035 (HDAC2)
   05220 Chronic myeloid leukemia
    475035 (HDAC2)
  09163 Neurodegenerative diseases
   05016 Huntington disease
    475035 (HDAC2)
  09164 Substance dependence
   05034 Alcoholism
    475035 (HDAC2)
  09167 Infectious diseases
   05169 Epstein-Barr virus infection
    475035 (HDAC2)
   05165 Human papillomavirus infection
    475035 (HDAC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cfa03036]
    475035 (HDAC2)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     475035 (HDAC2)
Chromosome and associated proteins [BR:cfa03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     475035 (HDAC2)
   HDAC complexes
    Sin3A-HDAC complex
     475035 (HDAC2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    475035 (HDAC2)
  Chromatin remodeling factors
   NuRD complex
    475035 (HDAC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 475035
NCBI-ProteinID: XP_013973700
Ensembl: ENSCAFG00000004049
VGNC: 49101
LinkDB All DBs
Position
12
AA seq 509 aa AA seqDB search
MHRDPGPAAGRPGSPHPRSGPQRGRRPRLRPALAGVSAGDIGNYYYGQGHPMKPHRIRMT
HNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGE
DCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVL
AILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGK
GKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTV
KGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFG
PDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDG
EDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKA
DVKEEDKSKDSSGEKTDTKGAKSEQLSNP
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgcaccgggacccgggtcctgcagccggcaggcccgggtccccccatccgcgctccggc
ccacagagggggcggcgaccgcgcctgcgccccgcgctcgctggggtctcggcaggtgat
attggaaattactattatggacagggtcatcccatgaaacctcatagaatccgcatgacc
cataacttgctgctaaattatggcttatatagaaaaatggaaatatacaggccccacaaa
gccactgctgaagaaatgacaaaataccacagtgatgagtacatcaaatttctacgttca
ataagaccagataacatgtctgagtatagtaagcagatgcagagatttaatgttggagaa
gactgtccagtgtttgatggactctttgagttttgccagctctcaacgggtggctcagtt
gctggtgctgtgaagttaaaccgacaacaaactgatatggctgttaactgggctggagga
ttacatcatgctaagaaatcagaagcatcaggattctgttatgttaatgatattgtactt
gccatccttgaattactaaagtatcatcagagagtgttatatattgatattgatatccat
catggtgatggtgttgaagaagctttttacacaacagatcgtgtaatgactgtatcattc
cataaatatggggagtactttcctggaacaggagacttgagggatattggtgcaggaaaa
ggcaaatactatgctgtcaattttccaatgagagatggtatagatgatgaatcctatggg
caaatatttaagcctattatctcaaaagtgatggagatgtatcaacccagtgctgtggtg
ctacagtgtggtgcagactcactgtctggtgataggcttggttgcttcaatctgacagtc
aaaggtcatgctaaatgtgtagaagttgtgaaaactttcaatttaccattactgatgctt
gggggaggtggatacacaattcgtaatgttgctcgatgttggacgtacgagactgcggtt
gcccttgattgtgagattcccaacgaactgccatataatgattactttgagtattttggc
ccggacttcaaactgcatattagtccttcaaatatgacaaaccagaacactccagaatat
atggaaaagataaaacagcgtttatttgaaaatttacgcatgttacctcatgcacctggc
gtccagatgcaagcaatcccagaagacgctgttcatgaagacagtggagatgaagatgga
gaagatccagacaagagaatttctattcgagcatcagacaaacggatagcttgtgatgaa
gaattctcagattctgaggatgaaggtgaaggaggacgtagaaatgtggccgatcataag
aaaggagcaaagaaagctagaattgaagaagacaagaaggaaacagaggacaaaaaagca
gatgttaaggaagaagataaatccaaggacagtagtggtgaaaaaacagataccaaagga
gccaaatcagaacagctcagcaacccttga

DBGET integrated database retrieval system