KEGG   Canis familiaris (dog): 475521Help
Entry
475521            CDS       T01007                                 

Definition
(RefSeq) cationic trypsin-like
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04080  Neuroactive ligand-receptor interaction
cfa04972  Pancreatic secretion
cfa04974  Protein digestion and absorption
cfa05164  Influenza A
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    475521
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    475521
   04974 Protein digestion and absorption
    475521
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    475521
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cfa01002]
    475521
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cfa04147]
    475521
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     475521
Peptidases [BR:cfa01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   475521
Exosome [BR:cfa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   475521
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 475521
NCBI-ProteinID: XP_532744
Ensembl: ENSCAFG00000003818
UniProt: F1PCE8
LinkDB All DBs
Position
16
AA seq 246 aa AA seqDB search
MKTFIFLALLGATVAFPIDDDDKIVGGYTCSRNSVPYQVSLNSGYHFCGGSLINSQWVVS
AAHCYKSRIQVRLGEYNIAVSEGGEQFINAAKIIRHPRYNANTIDNDIMLIKLSSPATLN
SRVSAIALPKSCPAAGTQCLISGWGNTQSIGQNYPDVLQCLKAPILSDSVCRNAYPGQIS
SNMMCLGYMEGGKDSCQGDSGGPVVCNGELQGVVSWGAGCAQKGKPGVYTRVCKYVSWIQ
QTIAAN
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaagacctttatcttcctcgctctactgggagccactgttgctttccccattgacgat
gatgacaagatcgtcgggggctacacttgttccaggaattccgtcccctaccaggtgtcc
ttgaactctggctaccacttctgtggcggctccctcatcaactcccagtgggtggtgtcc
gcggctcactgctacaagtcccgaatccaggtgcgtctgggagagtacaacatcgcagtc
tctgagggtggagaacaattcatcaatgcagccaagatcatccgccaccccagatacaac
gcaaacactatcgataacgacatcatgctgatcaaactgagctctcctgccaccctcaac
tctcgagtgtctgctatcgctctgccaaaatcctgtccagctgctggtacccagtgcctc
atctctggctggggaaatacccagagcatcgggcaaaactatcctgatgtcctgcagtgt
ctgaaggctcccatcctttctgacagcgtttgccgtaatgcataccctggccagatctcc
agcaacatgatgtgtttgggctacatggagggtggaaaggactcttgccagggtgactct
ggtggccctgtggtctgcaacggagagctccagggcgttgtctcctggggtgccggctgt
gctcaaaaaggcaaacctggtgtctacaccagggtctgcaaatacgtgagctggattcag
cagaccatcgctgccaactaa

DBGET integrated database retrieval system