KEGG   Canis familiaris (dog): 475523Help
Entry
475523            CDS       T01007                                 

Gene name
MGAM
Definition
(RefSeq) maltase-glucoamylase, intestinal isoform X2
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00052  Galactose metabolism
cfa00500  Starch and sucrose metabolism
cfa01100  Metabolic pathways
cfa04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    475523 (MGAM)
   00500 Starch and sucrose metabolism
    475523 (MGAM)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    475523 (MGAM)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     475523 (MGAM)
    3.2.1.20  alpha-glucosidase
     475523 (MGAM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 475523
NCBI-ProteinID: XP_013975431
Ensembl: ENSCAFG00000003841
VGNC: 43211
UniProt: E2RT38
LinkDB All DBs
Position
16
AA seq 1833 aa AA seqDB search
MARRRWKDFTTLELMLSVLLLMVFIITIPLFVLSAQDSLESKDPGTVVTPDPGTASTTPN
SAVCPVVDEAERINCIPDQPPTKATCDQRGCCWRPQGTINVPWCYYSRSHGYQGEGDVVK
TNAGFTAQLKRLPSPSLFGNDVNNVLLTAEYQTSNRFHFKLTDQSKDRYEVPHEHVQPFK
GDAASPLTYEVEVSKQPFSIKVIRTSNNRVLLDSGIGPLLFADQFLQFSTRLPSANVYGL
GEQVHQQYRHDMNWKTWPIFARDTTPNGDGTNLYGAQTFFLCLEDASGLSFGVFLMNSNA
MEVALQPTPAITYRTIGGILDFYVFLGNTPEQVVQEYLELIGRPALPSYWALGFHLSRYD
YGTLESMREVVQRNRVARLPYDVQHADIDYMHERKDFTYDPVNYKGFPEFVKELHNNSQK
LVIIVDPAISNNSSPSNPYGPYDRGSGAKIWVNASDGLTPLIGEVWPGKTVFPDYTNPSC
AVWWAKEFELFHNKIEFDGIWIDMNEVSNFVDGSISGCSTSHLNYPPFVPRILDGYLFSK
SLCMDAVQHWGKQYDVHNLYGYSMAIATAEAVKTVFPNKRSFILTRSTFAGSGKFAAHWL
GDNAATWNDLRWSIPGMLEFNLFGIPMVGADICGFALDTSEELCRRWMQLGAFYPFSRNH
NGQGYKAQDPASFGADSLLLNSSRHYLNIRYTLLPYLYTLFYRAHSRGDTVARPLMHEFY
GDSSTWDVHQQFLWGPGLLITPVLDEGAEKVMAYIPDAVWYDYETGARARWRKQRVEMGL
PADKIGLHLRGGHIFPTQQPATTTVASRRNPLGLIIALDENKEAKGELFWDDGETKDTVA
NQVYLLCEFSVTQNRLDVKILQSTYKDPNNLVFKEIKILGTQEPTNVIVKHNGIPSQTSP
NVTYDSNLQVALITEIDLILGEAYTVEWDLKIRDEEKIDCFPDESGASAANCTARGCAWE
ASSSPGVPFCYFVNDLYSVSDVQYDSHGATATISLKSSVYASALPSVPVTSLRLRVTYHK
NDMLQFKIYDPNNNRYEVPVPLNIPRVPSSTSESQLYDVLIKKNPFGIEIRRKSTGTVIW
DSQLLGFTFNDMFIRISTRLPSQYLYGFGETEHTAFRRDLNWHTWGMFSRDQPPGYKKNS
YGVHPYYMALEEDGSAHGVLLLNSNAMDVTFQPLPALTYRTIGGILDFYVFLGPTPELVT
QQYTEMIGRPVMVPYWSLGFQLCRYGYQNDSEIASLYDEMVAAQIPYDVQYSDIDYMERQ
LDFTLSPKFAGFPALITRMKANGMRVILILDPAISGNETQPYPAFTRGVEDDVFIKAPNG
GGIVWGKVWPDFPDVVINASLDWDSQVELYRAYVAFPDFFRNSTTTWWKRELQELYTNPQ
NPERSLKFDGMWIDMNEPASFVNGAVPPGCRDATMNHPPYMPHLESRDKGLSSKTLCMES
EQVLPDGSRVRHYDVHSLYGWAQTRPTYEAVQEVTGQRGIVITRSTFPSSGRWGGHWLGD
NTAAWDQLKKSIIGMMEFSLFGISYTGADICGFFQDAEYEMCVRWMQLGAFYPFSRNHNT
IGTRRQDPVSWNATFEDISRSVLQTRYTLLPYLYTLMHLAHTEGSTVVRPLLHEFVSDRV
TWNVDSQFLLGPAFLVSPVLEPNARNVTAYFPRARWYDYYTGVDIGARAEWKSLPAPLDH
INLHVRGGYILPWQEPAQNTHLSRQKFIGFKVALDDEGAAKGWLFWDDGQSIDTYGKGHY
YLANFSASQNMMQSHIVFNKYITDANPLKLGYVEIWGVGSVSISSVSISVSGMVITPTFT
YNPATQVLSIDVTGRDISLHNFISLTWRSTLNF
NT seq 5502 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaaggaggtggaaagatttcacgactttggagcttatgctcagtgttcttctg
cttatggtgtttatcatcactattcctctgtttgtgctttcagctcaagattctttggaa
tcaaaagatcctgggacagtagttaccccagatcctgggacagcaagtaccacccctaat
tctgctgtgtgcccggtggtagatgaagcagaacggatcaactgcattcctgaccagcca
ccaacaaaggccacatgtgatcagcgtgggtgctgctggagacctcaggggaccataaat
gtaccctggtgctactattctaggagtcatggttatcaaggggagggtgatgttgtaaaa
acgaatgcagggttcacagcccagttgaagaggttgccttctccatccctatttggaaat
gatgtcaacaatgtccttctcacagcagagtatcagacgtccaatcgcttccactttaag
ttaactgatcagagcaaagacaggtatgaagtgccccatgaacatgtgcaaccctttaaa
ggagatgctgcttcacccttgacctatgaagttgaggtttccaaacagccatttagcatc
aaagtaatcagaacaagcaataatcgtgttctgctggactcaggcattggacccctcctg
tttgctgatcagttcctgcaattctccacccgactgcccagtgctaatgtgtacggtctg
ggagaacaggtgcaccaacagtacaggcatgatatgaattggaagacctggcctatattt
gcccgggacacaactcccaatggggatggaactaacttgtatggtgcacagacattcttc
ctgtgtcttgaagatgctagtggattgtcctttggagtgtttctaatgaacagcaatgcc
atggaggttgccctccagcccaccccagccatcacttaccgcaccatcgggggcattctc
gacttctatgtgtttttgggaaacactccagagcaagttgttcaagagtatctagagctc
attggacggccagcccttccctcatactgggcccttggatttcatctcagtcgttatgat
tatggaacgctagagagcatgagggaagtcgtgcagagaaaccgtgtggctcggctccct
tatgacgtgcagcatgctgatattgattatatgcatgagaggaaggacttcacttatgat
ccagtaaattataaaggcttccctgagtttgttaaggagttacacaataacagtcagaaa
ttggtcatcattgtggatccagccatctccaacaactcttcccccagcaatccttacggc
ccatatgacagaggttcaggtgcaaagatatgggtgaatgcttcagatgggttgacgccg
ctcattggagaggtctggcctggaaaaactgtgtttcctgattataccaaccctagctgt
gctgtttggtgggcaaaggaatttgagcttttccacaacaaaatagaatttgatggaatc
tggattgatatgaatgaagtctccaactttgttgatggttccatttcagggtgttccacg
agccatcttaattatcccccatttgttcccagaatcctggatgggtacctgttctccaag
agtctctgcatggatgcagtgcagcattggggcaagcagtacgacgtccacaatctgtat
ggctactccatggcgatcgccacggcagaagctgtcaagaccgtgttccctaataagaga
agcttcattttaacccgttctacctttgcgggatctggcaagtttgcagcccactggtta
ggagacaatgcggccacctggaatgatcttcggtggtctatccctggcatgctcgagttc
aacctttttggtatcccaatggtgggtgctgacatatgtggctttgcactggacacctct
gaggagctctgtaggaggtggatgcagctgggagcattttatccattttccaggaatcac
aatggccaaggctacaaggcccaggatcctgcctcttttggagctgactctctgctgttg
aactcctccaggcactaccttaacatccgttacactctattaccctacctctacaccctc
ttctaccgtgcccacagccggggggacacagtggccaggccccttatgcatgagttctat
ggggatagcagtacatgggatgtacaccaacagtttttatggggacccggcctcctcatc
actccagttctggatgagggtgcagagaaagtgatggcttatatacccgatgccgtctgg
tacgattatgagactggggcccgagcaagatggaggaagcaaagagtggagatgggactt
cctgcagacaaaattggacttcaccttcgcggaggccacatctttcccacacaacagcca
gccaccaccacggtggccagtcgccggaacccccttggtcttatcattgccctggatgaa
aacaaagaagcaaaaggcgaacttttctgggatgatggggaaactaaagatactgtggcc
aatcaagtttatctcttatgtgagttttctgtcacccaaaaccgcttggatgtgaagatt
ttgcagtcaacttacaaagaccccaataatttagtatttaaagagattaaaattcttggg
acccaggaacctaccaatgttatagtgaaacacaatggtatcccaagtcaaacttctcct
aatgtcacttatgattctaacctacaggttgctcttatcacagaaattgatcttatcctc
ggagaagcatacacggtggagtgggacctgaagataagggatgaagagaaaatagactgt
tttcctgatgagagcggtgcttctgcagcaaactgtactgcccgtggctgtgcctgggag
gcatccagttctcctggagtcccattctgttattttgtcaacgatctgtactctgtcagc
gatgttcagtatgactcacatggagccactgctaccatctccttaaaatcttctgtctat
gcctccgctctgccctcagtgcccgtgacttctctccgcctacgtgtgacctaccataag
aatgacatgctacagtttaagatttatgatcccaataataatcggtatgaagtcccagtc
cctctcaacatacccagggttccatccagcacctctgagagtcaactctatgatgtcctc
attaagaagaatccatttggaatcgaaattcgccggaagagtacgggcactgtgatttgg
gactctcagctccttggctttaccttcaatgacatgttcatccgtatctccactcgcctt
ccctcccagtacctctatggttttggggaaactgagcacacagcctttcggagagacttg
aactggcacacatgggggatgttctccagggaccaacctccggggtacaagaagaattcc
tatggtgtccacccctactacatggcactggaggaggatggtagtgcccatggggtgtta
ctgctcaacagcaatgccatggatgtgacattccagcccctgcctgccttgacataccgc
accataggaggaattctggacttttatgtgttcttggggccaactccagagcttgtcact
cagcagtatactgagatgattggtcggccagtgatggttccttactggtccttggggttt
cagctgtgtcgctatggctaccagaacgactctgagattgccagcctgtatgatgagatg
gtggctgcccagatcccttatgatgtgcagtactccgacatcgactacatggagcggcag
ctggacttcaccctcagccccaagttcgcaggatttccagctctgattactcgcatgaag
gccaacggaatgcgggtcatcctcattctggacccagccatttctggtaatgagacgcag
ccctatcctgcattcactcggggtgtggaggatgatgtcttcatcaaagctccaaatggt
ggaggcattgtctgggggaaggtgtggcctgatttccctgatgtcgtcataaacgcatcc
ctagactgggatagtcaagtggagctgtaccgagcttatgtggcctttcctgactttttc
cgtaactccactaccacatggtggaagagggagctgcaagaactatacaccaacccccag
aatccagagaggagcttgaagtttgacggcatgtggattgatatgaatgagccagcaagt
tttgtgaatggagcagtccccccaggctgcagggatgccactatgaaccaccccccctat
atgccacatttggagtccagggataaaggcctgagcagcaagaccctgtgcatggagagc
gagcaggtcctgccagatggctcacgggtgcggcactatgatgttcacagcctgtatgga
tgggcccagaccagacccacctacgaagctgtgcaggaggtgacgggacagagagggatt
gtcatcacccgctccacattcccctcttctggccgctggggaggccactggctgggtgac
aacacggccgcgtgggaccagctgaagaagtctatcattggcatgatggagttcagcctc
ttcggtatatcttatacaggagcagatatttgtgggttctttcaagatgctgaatatgag
atgtgtgttcgctggatgcagctgggagccttttaccccttttcgaggaaccacaacacc
attgggaccaggaggcaagaccctgtgtcctggaatgcaacctttgaggatatctccaga
agtgtgctgcagaccagatacaccctgttgccatatctctacaccctgatgcacctggcc
cacacggagggcagtactgtcgtgcggcctcttctccatgagtttgtgtcagaccgggtg
acctggaatgtagacagtcagtttctgctgggcccagccttcctagtcagccctgtcctg
gagcctaatgccagaaatgtcactgcatatttccctagagcccgctggtatgattactac
acgggtgtggacattggagcaagggcagagtggaagtccttgccagcccctcttgaccac
attaaccttcatgtccgtgggggctacatcctgccctggcaagagcctgcgcagaacacc
cacttaagccgtcagaaattcataggcttcaaggttgctttggatgatgagggggctgct
aaaggctggctcttctgggatgatgggcaaagcattgacacctatggaaaaggacactat
tacctggccaacttttctgccagccagaatatgatgcagagtcatatagttttcaacaaa
tacatcaccgatgcaaaccctttgaaactgggctacgttgagatctggggagtgggcagt
gtttccatttccagtgtcagcatctctgtgagcggcatggtgataacgcccaccttcact
tacaaccctgcaacacaggtgttaagcattgatgtgaccggcagagatatcagcctccat
aatttcatttcactgacgtggagaagcactctgaatttttag

DBGET integrated database retrieval system