KEGG   Canis familiaris (dog): 476258Help
Entry
476258            CDS       T01007                                 

Gene name
SOD2
Definition
(RefSeq) superoxide dismutase [Mn], mitochondrial
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04068  FoxO signaling pathway
cfa04146  Peroxisome
cfa04211  Longevity regulating pathway
cfa04213  Longevity regulating pathway - multiple species
cfa05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    476258 (SOD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    476258 (SOD2)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway
    476258 (SOD2)
   04213 Longevity regulating pathway - multiple species
    476258 (SOD2)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05016 Huntington disease
    476258 (SOD2)
Enzymes [BR:cfa01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     476258 (SOD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 476258
NCBI-ProteinID: XP_533463
Ensembl: ENSCAFG00000000671
UniProt: E2RSF2
LinkDB All DBs
Position
1
AA seq 222 aa AA seqDB search
MLSRAALSTSRTLVPALGCLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVN
NLNTIEEKYLEALEKGDITAQIALQPGLKFNGGGHINHSIFWTNLSPKGGGEPKGELLEA
IKRDFGSFDKFKEKLTTVSVGVQGSGWGWLGFNKEQGRLQIAACFNQDPLQGTTGLIPLL
GIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcccgggcggcgctcagcacgagcaggacgctggtgccggcgctggggtgtctg
gggtcccggcagaagcacagcctccccgacctgccgtacgattatggcgccctggagcct
cacatcaacgcccagatcatgcagctgcaccacagcaagcaccacgccgcctacgtgaac
aacctgaacaccatcgaggagaagtatctggaggcgctggagaagggtgacattacagct
cagatagctcttcagcctgggctcaagttcaatggaggaggtcatatcaatcattccatc
ttctggacaaacctgagccctaagggtggtggagaaccaaaaggggaattgctggaagcc
atcaaacgtgattttggttccttcgacaaatttaaggagaagttgaccactgtatccgtc
ggtgtccaaggctcaggttggggttggcttggtttcaataaggagcagggacgcttgcag
attgctgcttgttttaaccaggatcccctgcaaggaacaacaggtcttattccactactg
gggatcgatgtgtgggagcatgcttattaccttcagtataaaaatgtcagaccggattat
ctaaaagctatttggaatgtaatcaactgggagaatgtaaccgagagatacatggcttgc
aaaaagtaa

DBGET integrated database retrieval system