KEGG   Canis lupus familiaris (dog): 477039
Entry
477039            CDS       T01007                                 

Gene name
TGFBR2
Definition
(RefSeq) TGF-beta receptor type-2 isoform X1
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa04010  MAPK signaling pathway
cfa04060  Cytokine-cytokine receptor interaction
cfa04068  FoxO signaling pathway
cfa04144  Endocytosis
cfa04218  Cellular senescence
cfa04350  TGF-beta signaling pathway
cfa04380  Osteoclast differentiation
cfa04390  Hippo signaling pathway
cfa04520  Adherens junction
cfa04659  Th17 cell differentiation
cfa04926  Relaxin signaling pathway
cfa04933  AGE-RAGE signaling pathway in diabetic complications
cfa05142  Chagas disease
cfa05161  Hepatitis B
cfa05166  Human T-cell leukemia virus 1 infection
cfa05200  Pathways in cancer
cfa05202  Transcriptional misregulation in cancer
cfa05210  Colorectal cancer
cfa05212  Pancreatic cancer
cfa05220  Chronic myeloid leukemia
cfa05225  Hepatocellular carcinoma
cfa05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    477039 (TGFBR2)
   04350 TGF-beta signaling pathway
    477039 (TGFBR2)
   04390 Hippo signaling pathway
    477039 (TGFBR2)
   04068 FoxO signaling pathway
    477039 (TGFBR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    477039 (TGFBR2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    477039 (TGFBR2)
  09143 Cell growth and death
   04218 Cellular senescence
    477039 (TGFBR2)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    477039 (TGFBR2)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    477039 (TGFBR2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    477039 (TGFBR2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    477039 (TGFBR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    477039 (TGFBR2)
   05202 Transcriptional misregulation in cancer
    477039 (TGFBR2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    477039 (TGFBR2)
   05212 Pancreatic cancer
    477039 (TGFBR2)
   05225 Hepatocellular carcinoma
    477039 (TGFBR2)
   05226 Gastric cancer
    477039 (TGFBR2)
   05220 Chronic myeloid leukemia
    477039 (TGFBR2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    477039 (TGFBR2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    477039 (TGFBR2)
   05161 Hepatitis B
    477039 (TGFBR2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    477039 (TGFBR2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cfa01001]
    477039 (TGFBR2)
Enzymes [BR:cfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     477039 (TGFBR2)
Protein kinases [BR:cfa01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   477039 (TGFBR2)
SSDB
Motif
Pfam: ecTbetaR2 PK_Tyr_Ser-Thr Pkinase Pkinase_fungal APH
Other DBs
NCBI-GeneID: 477039
NCBI-ProteinID: XP_005634388
Ensembl: ENSCAFG00000005449
VGNC: 47312
UniProt: A0A5F4D8G5
LinkDB
Position
23
AA seq 561 aa
MMCHVTPSYAERSCPCSLPLVNDFLVNNDMMVTDSNGVIKFPQLCKFCDVRSSTCDNQKS
CMSNCSITSICEKPHEVCLAVWRKNDENITLETLCHDPKDTYHGIVLEDAASSKCIMKEK
KVLGETFFMCSCSSDECNDYIIFSEEYATNNPDLLLVIFQVTGVSLLPPLGIAIAVIVTF
YCYRVHRQQKLSPSWETSKPRKLMEFSEHLAIILEDDRSDISSTCANNINHNTELLPIEL
DTLVGKGRFAEVYKAKLKQNTSEQFETVAVKIFPYEEYASWKTEKDIFSDINLKHENILQ
FLTAEERKTELGKQYWLITAFHAKGNLQEYLTRHVISWEDLRKLGSSLARGIAHLHSDHT
LCGRPKMPIVHRDLKSSNILVKNDLTCCLCDFGLSLRLDPTLSVDDLANSGQVGTARYMA
PEVLESRMNLENVESFKQTDVYSMALVLWEMTSRCNAVGEVKDYEPPFGSKVREHPCVES
MKDNVLRDRGRPEIPSSWLNHQGIQMVCETLTECWDHDPEARLTAQCVAERFSELEHLDR
LSGRSCSEEKIPEDGSLNTTK
NT seq 1686 nt   +upstreamnt  +downstreamnt
atgatgtgccatgtgaccccatcatatgctgaaagaagctgcccatgctcacttccttta
gtgaatgactttctagttaataatgacatgatggtcactgacagcaatggtgtcatcaaa
tttccacaattgtgtaaattttgtgatgtgagatcttccacctgtgacaaccagaaatct
tgcatgagcaactgcagcattacatccatctgtgagaagccacatgaagtctgtctggct
gtctggagaaagaatgatgagaacataacactagagactctctgccatgaccccaaggat
acctaccatggaattgttctcgaagatgctgcctcttcgaagtgcattatgaaagaaaag
aaggtgctgggggagactttctttatgtgttcctgtagctccgacgagtgcaacgactac
atcatcttctctgaagaatatgccaccaacaaccctgacttgttgttagtcatattccaa
gtgacaggcgtcagcctcctgccgcccctgggaatcgccatagccgtcattgtcaccttc
tactgttaccgcgttcatcggcagcagaagctgagcccatcatgggagaccagcaagcca
cggaagctcatggagttcagcgagcacctggccatcattctggaagacgaccggtccgac
atcagctctacctgcgccaacaacatcaaccacaacacggagctgctgcccattgagctg
gacaccctggtggggaaaggtcgctttgctgaggtctacaaggccaagctgaagcagaac
acttcagagcagttcgagactgtggcagtcaagatcttcccttacgaggagtatgcctcc
tggaagacggagaaggacatcttctcagacatcaatctgaagcacgagaacatactgcag
ttcctgacagccgaggagcggaagacggagctgggaaagcagtattggctgatcacggcc
ttccatgccaagggcaacctgcaggagtacctcactcggcatgtcatcagctgggaggac
ctgcgaaagctgggcagctccctcgcccggggcattgctcacctgcacagtgaccacacc
ctgtgtgggaggcccaagatgcctattgtgcacagggacctcaagagctccaatatcctg
gtgaagaacgacctgacctgctgcctgtgtgactttggcctttccctgcgcctggaccca
actctgtctgtggatgacctggccaacagtgggcaagtgggaactgcaagatacatggct
cccgaagtcctagagtccaggatgaatttggagaacgttgaatcctttaagcagactgat
gtctactccatggccctggtactctgggaaatgacatctcgctgtaatgcagtgggagaa
gtgaaagattatgagcccccgtttggttccaaggtgcgagagcatccctgcgttgagagc
atgaaggacaatgtgctgagagaccgaggacgaccagaaattcccagctcctggctcaac
caccagggcatccagatggtgtgcgagactctgaccgagtgctgggaccacgacccggag
gcccggctcacggcccagtgcgtggcggagcgcttcagtgaactggagcacctggacagg
ctctcagggaggagctgctctgaggagaagattcccgaagatggctcgctgaacactacc
aaatag

DBGET integrated database retrieval system