KEGG   Canis familiaris (dog): 477264Help
Entry
477264            CDS       T01007                                 

Gene name
DPM1
Definition
(RefSeq) dolichol-phosphate mannosyltransferase subunit 1 isoform X2
  KO
K00721  dolichol-phosphate mannosyltransferase [EC:2.4.1.83]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00510  N-Glycan biosynthesis
cfa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    477264 (DPM1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:cfa01003]
    477264 (DPM1)
Enzymes [BR:cfa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.83  dolichyl-phosphate beta-D-mannosyltransferase
     477264 (DPM1)
Glycosyltransferases [BR:cfa01003]
 N-Glycan biosynthesis
  Dol-P-Man biosyntheisis
   477264 (DPM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3
Motif
Other DBs
NCBI-GeneID: 477264
NCBI-ProteinID: XP_022264890
Ensembl: ENSCAFG00000030079
VGNC: 40070
LinkDB All DBs
Position
24
AA seq 110 aa AA seqDB search
MASEEASGSPRRSRREPEGRAPRQDKYSVLLPTYNERENLPLIVWLLVKSFSESGINYEI
IIIDDGSPDGTRDVAEQLEKIYGSDKILLRPREKKLGLETIPSCLPKLSS
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggcctccgaggaagcgagcggtagccctcgtaggtctcggcgggagccggaggggcgc
gccccgcgacaggacaagtattcggtgctgttgcctacctacaacgagcgcgagaaccta
ccgctcatcgtgtggctgctggtgaaaagcttctccgagagtggaatcaattatgaaatt
ataatcatagatgatggaagcccagatggaacaagggacgttgctgaacagctggagaag
atctatgggtcagacaaaattcttctgagaccacgggagaaaaagttaggcctagaaact
atcccctcctgccttccaaaactatccagttga

DBGET integrated database retrieval system