KEGG   Canis familiaris (dog): 478217Help
Entry
478217            CDS       T01007                                 

Gene name
SDHB
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00020  Citrate cycle (TCA cycle)
cfa00190  Oxidative phosphorylation
cfa01100  Metabolic pathways
cfa01200  Carbon metabolism
cfa04714  Thermogenesis
cfa04932  Non-alcoholic fatty liver disease (NAFLD)
cfa05010  Alzheimer disease
cfa05012  Parkinson disease
cfa05016  Huntington disease
Module
cfa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cfa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cfa_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    478217 (SDHB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    478217 (SDHB)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    478217 (SDHB)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    478217 (SDHB)
   05012 Parkinson disease
    478217 (SDHB)
   05016 Huntington disease
    478217 (SDHB)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    478217 (SDHB)
Enzymes [BR:cfa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     478217 (SDHB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_7 Fer4_9 Fer4_18
Motif
Other DBs
NCBI-GeneID: 478217
NCBI-ProteinID: NP_001239146
Ensembl: ENSCAFG00000015832
VGNC: 45951
UniProt: F1Q3W8
LinkDB All DBs
Position
2
AA seq 280 aa AA seqDB search
MAAVVGVSLKRRFPAAALGGACLQACRGAQTAAATAPRIKKFAIYRWDPDKTGDKPHMQT
YEIDLNKCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTN
LSKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEDREKL
DGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSL
YRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKGKKASV
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggtggtcggagtctccttgaaacgccggttcccggctgcagccctcggcgga
gcctgcctgcaggcctgccggggggcacagacagcggcagccacagctccccgaatcaag
aaatttgccatctaccgatgggacccagacaagactggagataaaccgcatatgcagact
tatgaaattgatttgaataaatgtggtcctatggtgttggatgctttaatcaagattaag
aatgaaattgactctaccttgaccttccgaagatcatgcagagaaggcatctgtggctcc
tgtgccatgaacatcaacggaggcaacactctggcttgcacccgccggatcgacaccaac
ctcagcaaagtctccaaaatctaccctctgccgcatatgtatgtgataaaggatctggtt
cctgacttgagcaacttctatgctcagtataaatccattgaaccttatttgaagaagaag
gatgaatcccaagagggcaagcagcagtatctgcagtccatagaagatcgtgagaaactg
gacgggctgtacgagtgtatcctctgtgcttgctgcagcaccagctgccctagctactgg
tggaatggagacaaatacctggggcctgcggttctcatgcaggcctaccgctggatgatc
gactccagagacgacttcactgaggagcgcctggccaagctgcaggacccgttctctctg
taccgctgccacaccatcatgaactgcacaaggacctgccccaaggggctgaatccaggc
aaagctattgctgaaatcaagaaaatgatggccacctataaggggaagaaagcgtccgtg
tga

DBGET integrated database retrieval system