KEGG   Canis familiaris (dog): 478517Help
Entry
478517            CDS       T01007                                 

Gene name
ENPEP
Definition
(RefSeq) glutamyl aminopeptidase
  KO
K11141  glutamyl aminopeptidase [EC:3.4.11.7]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04614  Renin-angiotensin system
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04614 Renin-angiotensin system
    478517 (ENPEP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cfa01002]
    478517 (ENPEP)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cfa04147]
    478517 (ENPEP)
   04090 CD molecules [BR:cfa04090]
    478517 (ENPEP)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.7  glutamyl aminopeptidase
     478517 (ENPEP)
Peptidases and inhibitors [BR:cfa01002]
 Metallo peptidases
  Family M1
   478517 (ENPEP)
Exosome [BR:cfa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   478517 (ENPEP)
CD molecules [BR:cfa04090]
 Proteins
  478517 (ENPEP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N Cyclophil_like DUF1570
Motif
Other DBs
NCBI-GeneID: 478517
NCBI-ProteinID: XP_535696
Ensembl: ENSCAFG00000011580
VGNC: 40373
UniProt: F6XRM5
LinkDB All DBs
Position
32
AA seq 954 aa AA seqDB search
MNFAEGEDAKRYCIRTRHVAVICAVVAAVGLIVGLSVGLTRAGSSPGGGGQGPAPGPPSQ
GPSPETPPPGDQGVCPASEDDSGDWKNFRLPDFISPVHYDLEVKPLLQEDTYTGSVAIAV
NVSAPTRHLWLHLRETRLTQLPELKAPSGAQVQVRRCFEYKKQEYVVVEAEQELAPSTGP
GTYLLTLRFAGWLNGSLVGFYRTTYEENGQIKSIAATDHEPTDARKSFPCFDEPNKKATY
NISIIHPKEYKAVSNMPVEKEESMDDKWNRTTFQKSVPMSTYLVCFAVHQFDYVQRTSKK
GIPLTIYVQPQQKHTAEYAANITKIAFDYFEEYFAMDYALPKLDEIAIPDFGTGAMENWG
LITYRETNLLYDPQESASSNQQRVASVVAHELVHQWFGNTVTMEWWEDLWLNEGFASFFE
FLGVNQAEKDWQMRDQMLLEDVLPVQEDDSLISSHPIVVTVATPAEITSVFDGISYSKGV
SILRMLEDWITPDKFRKGCQIYLERYKFGNAKTEDFWRALEEASKFPVKEVMDTWTKQMG
YPVLNVKDRKNITQKRFLLDSRANLSEPHSPLGYTWNIPVKWTEDNVSSITFYNRSETGG
ITLNSSNPAGNFFLKINPDHIGFYRVNYEIPTWEWIATNLFLNHKNFSSADRASLIDDAF
ALARAQLLDYKMALNLTKYLKMEEEFLPWQRVISAVTYIISMFEDDTELYPVIEEYFQSR
VKPIADLLGWNDVGDHLTKLLRASVLGLACKMGDQEALNNATQLFQQWLSGTVRLPVNLR
LLVYRYGMQNSGNETSWNYTLDQYQKTSLAQEKEKLLYGLASVKNVTLLSRYLDLLKDPN
LIKSQDVFTVIRYISYNSYGKTMAWNWIQLNWEYLVNRYTINDRNLGRIVTVAEPFNTEL
QLWQMESFFKRYPDAGAGEKPREQVLETVKNNIEWLRQNRNTIRQWFLDLPKNG
NT seq 2865 nt NT seq  +upstreamnt  +downstreamnt
atgaactttgcggagggagaggacgccaagaggtactgcatcaggacgagacacgtggcg
gtgatctgcgcggtggtggcggcggtgggactgatagtgggcctgtcggtgggcttgacc
cgggccggcagctccccggggggcggcggccagggccccgcgcccggccccccctcgcag
ggcccttcgcccgagaccccgccgcccggggaccagggggtctgtcccgccagcgaagat
gacagcggggactggaagaacttccggctgccggacttcatcagcccggtgcactacgac
ctggaggtgaagcccctgctgcaggaggacacgtacacgggcagcgtggccatcgcggtc
aacgtgagcgcgcccacccggcacctgtggctgcacctgcgggagaccaggctcacgcag
ctgcccgagctgaaggcgccctcgggggcgcaggtgcaggtccgccggtgcttcgagtac
aagaagcaggagtacgtggtggtggaggcggagcaagagctcgcccccagcactggcccg
gggacctacctcctgaccctcaggttcgccggctggctgaacggctcgctcgtgggattt
tacaggacgacctacgaggagaacggacagatcaagagcatagcagccactgatcacgaa
ccaacagatgccaggaaatccttcccttgttttgatgagcccaacaaaaaggcaacttat
aatatatccatcatccaccccaaagaatacaaagcagtttcaaatatgccagtggagaaa
gaagaatcgatggatgataaatggaatagaacaactttccagaagtctgtccctatgagc
acctacctggtgtgctttgctgtacatcaatttgactatgttcagagaacatcaaaaaag
ggaatacctctcactatatatgtccagccacagcaaaagcacacagctgaatatgctgca
aacataactaagatcgcatttgactattttgaagaatactttgctatggattatgctctt
cctaaattagatgaaatcgctattccagactttggcactggggctatggagaactgggga
ctcatcacttacagagaaacaaacttgctttatgaccctcaggaatcagcctcttcaaac
cagcagagggtggccagtgtggttgcccatgaacttgtgcatcagtggtttggcaatacc
gtgaccatggaatggtgggaagacttgtggctaaatgaaggatttgcttccttctttgag
ttcctgggagtaaaccaagcagaaaaagactggcaaatgagagaccagatgttacttgaa
gatgtattacctgtacaagaagatgattctttgatatcttcacacccaattgttgtcact
gtggcaactcctgctgaaataacatctgtttttgatggaatatcctatagcaagggagtt
tccattctgaggatgcttgaagactggataacaccagacaaatttcggaaaggatgccag
atttacttggaaagatacaaatttgggaatgcaaaaactgaagatttttggagagcactt
gaagaggcaagtaagtttccagtgaaagaagtaatggatacgtggaccaaacagatgggt
tatcctgtacttaatgtgaaagatagaaagaatatcacacagaaacgttttctattggac
tcaagagctaatctttctgagccacattcacctcttggttacacatggaatattccagtt
aaatggactgaagataatgtatcaagtattacattctacaacaggtcagaaacaggagga
atcactttgaattcttctaatcctgctggaaatttttttctcaaaataaacccagatcat
attgggttttatcgtgtaaattatgaaataccaacttgggaatggatagctaccaatctt
ttcttaaaccacaagaacttttcttctgctgaccgtgcaagtcttatagatgatgctttt
gccttggcaagagctcaacttctagattataaaatggctctaaacttgaccaagtatctc
aaaatggaagaagagtttttaccatggcagagagtaatttcagctgtaacctatatcatt
agcatgttcgaagatgatacagaactctaccctgtgattgaggaatacttccaaagtcga
gtgaagcccattgcagatcttctaggatggaatgacgtcggagaccaccttacaaagttg
ctccgtgcctccgtattagggcttgcatgcaaaatgggagatcaagaagccttgaacaat
gctacacaattatttcagcagtggctaagtgggactgtaaggcttcctgtaaatctgagg
cttctggtatatcggtatggaatgcagaactctggcaatgagacttcatggaactacact
cttgatcaataccagaaaacttcattagctcaggaaaaagaaaaactgctgtatggatta
gcatcagtgaagaacgttactctcttgtcaagatatttagatttgctcaaggacccaaac
cttattaaaagtcaggatgtgtttacagtcatccgatatatctcatataacagctatgga
aagactatggcctggaattggattcagctcaactgggaatatctagttaacagatacaca
atcaatgacagaaatcttggcaggattgtcacagtagcagaaccattcaacactgaacta
cagctgtggcagatggagagctttttcaaaagatatccagatgctggagcaggagaaaaa
cccagggaacaagtgctggaaacagtgaagaacaatatcgagtggttaagacaaaatagg
aacacgataagacagtggtttttggatttacctaagaatggctaa

DBGET integrated database retrieval system