KEGG   Canis familiaris (dog): 478634Help
Entry
478634            CDS       T01007                                 

Gene name
SDHA
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial isoform X1
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00020  Citrate cycle (TCA cycle)
cfa00190  Oxidative phosphorylation
cfa01100  Metabolic pathways
cfa01200  Carbon metabolism
cfa04714  Thermogenesis
cfa04932  Non-alcoholic fatty liver disease (NAFLD)
cfa05010  Alzheimer disease
cfa05012  Parkinson disease
cfa05016  Huntington disease
Module
cfa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cfa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cfa_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    478634 (SDHA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    478634 (SDHA)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    478634 (SDHA)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    478634 (SDHA)
   05012 Parkinson disease
    478634 (SDHA)
   05016 Huntington disease
    478634 (SDHA)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    478634 (SDHA)
Enzymes [BR:cfa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     478634 (SDHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO
Motif
Other DBs
NCBI-GeneID: 478634
NCBI-ProteinID: XP_013965792
Ensembl: ENSCAFG00000010951
VGNC: 45949
LinkDB All DBs
Position
34
AA seq 665 aa AA seqDB search
MSGVRAVSRLLGARRLALTRAQWPAAWQTGTRSFHFTIDGNKRSSAKVSDSISTQYPVVD
HEFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEEDNW
RWHFYDTVKGSDWLGDQDAIHYMTEQAPASVVELENYGMPFSRTEDGRIYQRAFGGQSLK
FGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGVIALCI
EDGSIHRIRAKNTVVATGGYGRTYFSCTSAHTSTGDGTAMVTRAGLPCQDLEFVQFHPTG
IYGAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTLEIREGRGCGP
EKDHVYLQLHHLPPEQLAIRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKG
QVLRHVNGQDQIVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALSIAESCRPGD
KIPPIKPNAGEESVMNLDKLRFANGSVRTSELRLNMQKSMQSHAAVFRVGSVLQEGCEKI
SQLYGDLKHLKTFDRGMVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHAREDYKV
RIDEYDYSKPIQGQQKKPFEEHWRKHTLSYVDIKTGKVSLEYRPVIDRTLNEADCATVPP
AIRSY
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggggtccgggcggtgtctcggctgctgggcgcccggcgcctggcgctgaccaga
gcacagtggccggcggcatggcagacaggcacccgcagttttcacttcaccattgatggg
aataagaggtcctctgctaaagtttcagattcaatctctacgcagtacccagtggtggac
catgaatttgatgcagtggtggtaggcgctggaggggcgggcttgcgagctgcatttggc
ctttcagaggctgggtttaacacggcctgcgtcacaaagctctttcccaccagatcacac
accgttgccgcccagggaggaatcaatgctgctctgggcaacatggaggaggacaactgg
aggtggcacttctacgacaccgtgaagggctccgactggctgggggaccaggacgccatc
cactacatgacagagcaggcccctgcttctgtggtagagctggagaattatggcatgcca
tttagcagaactgaagatggaaggatctatcagcgtgcttttggtggacagagcctcaag
tttgggaaaggcgggcaggcccatcggtgctgctgtgtggctgaccgcactggccactcg
ctgctgcacacgttgtatggaaggtctctgcgatatgataccagctattttgtagagtac
tttgccttggatctcttgatggaaaatggagaatgtcgtggtgttattgcactgtgcata
gaagatgggtccatccatcgcataagagccaagaacactgttgtggctaccggaggttat
gggcgcacctacttcagctgcacatctgcccacaccagcaccggtgacggcaccgccatg
gtcaccagggcaggccttccctgccaggacttggagttcgttcagttccaccccacaggt
atatatggtgctggttgtctcattacggaaggatgccgtggagagggaggcattctcatt
aacagtcaaggcgaaaggttcatggagcgatatgccccagtcgcaaaggacctggcatcc
agagacgttgtatctcggtccatgactctggaaatccgtgaaggcagaggctgtggcccc
gaaaaagaccatgtgtacctgcagttgcaccacctaccgcccgagcagttggccatacgt
ctgcctggcatttcagagacggccatgatctttgccggtgtggatgtcaccaaggagcca
atccccgtccttcccactgtgcattataacatgggtggcattcccaccaactacaagggg
caggttctgaggcacgtgaatggccaggatcagattgtgcctggcctgtatgcatgcggg
gaggccgcctgcgcctcggtgcacggtgccaaccgcctcggagccaactcgctcttggac
ttggtcgtctttggccgggcatgtgccctgagtatcgcagagtcctgcagacctggagat
aaaattcccccgattaaaccaaatgccggggaagagtctgtcatgaatcttgacaaactg
agatttgccaatggaagtgtaagaacatctgaactacgactcaacatgcagaagtcgatg
cagagtcatgctgctgtgttccgtgtgggaagtgtgttacaggaaggctgtgagaaaatc
agccagctctatggagacctaaagcatctgaagacatttgaccgaggaatggtctggaac
accgacctggtagagaccctggagctgcagaacctgatgctctgtgcacttcagaccatt
tatggagcagaggcccggaaggagtcacgtggcgctcacgccagggaagattacaaggtg
cggattgacgagtatgattactctaagcccatccagggacagcagaagaagccgtttgag
gagcactggagaaagcacaccctttcctacgtcgatatcaagactgggaaggtctcattg
gaatatagacctgtgatcgacagaactttaaatgaggctgactgtgccacggtccctcca
gccattcgctcctactga

DBGET integrated database retrieval system