KEGG   Canis familiaris (dog): 478794Help
Entry
478794            CDS       T01007                                 

Gene name
GAD1
Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00250  Alanine, aspartate and glutamate metabolism
cfa00410  beta-Alanine metabolism
cfa00430  Taurine and hypotaurine metabolism
cfa00650  Butanoate metabolism
cfa01100  Metabolic pathways
cfa04727  GABAergic synapse
cfa04940  Type I diabetes mellitus
Module
cfa_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    478794 (GAD1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    478794 (GAD1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    478794 (GAD1)
   00430 Taurine and hypotaurine metabolism
    478794 (GAD1)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    478794 (GAD1)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    478794 (GAD1)
Enzymes [BR:cfa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     478794 (GAD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase DegT_DnrJ_EryC1 SepSecS OKR_DC_1
Motif
Other DBs
NCBI-GeneID: 478794
NCBI-ProteinID: NP_001091012
Ensembl: ENSCAFG00000012560
VGNC: 41067
UniProt: A0PA85
LinkDB All DBs
Position
36
AA seq 594 aa AA seqDB search
MASSTPSSSATSSNAGADPNTANLRPTTYDTWCGVAHGCTRKLGLKICGFLQRTNSLEEK
SRLVSAFKERQSSKNLLSCENSDRDGRFRRTETDFSNLFARDLLPAKNGEEQTVQFLLEV
VDILLNYVRKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDHPESLEQILVDCRDTLKYGV
RTGHPRFFNQLSTGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQITLKKMREIVGWS
SKDGDGIFSPGGAISNMYSIMAARYKFFPEVKTKGMAAVPKLVLFTSEHSHYSIKKAGAA
LGFGTDNVILIKCNERGKIIPADLEAKILEAKQKGYVPLYVNATAGTTVYGAFDPIQEIA
DICEKYNLWLHVDAAWGGGLLMSRKHRHKLSGIERANSVTWNPHKMMGVLLQCSAILVKE
KGILQGCNQMCAGYLFQPDKQYDVSYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFENQI
NKCLELAEYLYAKIKNREEFEMVFDGEPEHTNVCFWYIPQSLRGIPDSPERREKLHRVAP
KIKALMMESGTTMVGYQPQGDKANFFRMVISNPAATQSDIDFLIEEIERLGQDL
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcttcgaccccttcttcgtccgcaacctcctcgaatgcgggagcggaccccaat
actgccaacctgcgccccacaacgtatgacacctggtgcggcgtggcccatggatgcacg
agaaaactgggtctcaagatctgcggcttcttgcaaaggaccaacagcctggaagagaag
agccggcttgtgagcgccttcaaggagaggcagtcctccaagaacctgctttcctgtgaa
aacagtgacagggatggccgtttccggcgcacagagactgatttctccaacctctttgct
cgagatctgcttccagctaagaatggggaggagcaaacagtgcagttcctcctggaagtg
gtagacatactcctcaactatgtccgcaagacatttgatcgctccaccaaggtactggac
ttccatcacccgcaccagctgctggaaggcatggagggcttcaacttggagctgtctgac
caccccgagtccctggagcagatcttggttgactgcagagacaccctgaagtatggggtc
cgtacaggtcatcctcgatttttcaaccagctctccactggattggatatcattggttta
gctggcgaatggctgacatcaactgccaataccaatatgtttacatatgaaattgcacca
gtatttgtcctcatggagcaaataacacttaagaagatgagagagatagttggatggtca
agtaaagatggtgatgggatattttctcctgggggagccatctccaacatgtacagcatc
atggctgctcgctacaagttcttcccggaagttaagacaaagggcatggcggccgttccc
aaactggtcctcttcacctcagaacacagtcactattccataaagaaggctggagctgca
cttggctttggaactgacaatgtgattttgataaagtgcaacgaaagggggaagataatt
ccagctgacttagaagcaaaaattcttgaagccaagcaaaagggatatgttcctctttac
gtcaatgcaactgctggcacgactgtgtatggggcttttgatccgatacaggagattgca
gatatatgtgagaaatataacctatggctgcatgtcgatgctgcctggggcggtgggctg
ctcatgtcccggaagcaccgccacaaactcagcggcatagaaagggccaactcagtcacc
tggaaccctcacaagatgatgggcgtgctgttgcagtgctctgccattcttgtcaaggaa
aagggtatactccaaggatgcaaccagatgtgtgcaggataccttttccagccagacaag
cagtacgacgtctcttatgacactggggacaaggcaatccagtgtggtcgccacgtggac
attttcaagttctggctgatgtggaaagcaaagggcacagtgggatttgaaaatcagatc
aacaaatgcttggaattggccgaatacctctatgccaagattaaaaacagagaagaattt
gagatggttttcgacggtgagcctgagcatacaaacgtctgtttctggtatattccacaa
agcctcaggggcattccagatagccctgaacgacgggaaaaactacacagggtggctccc
aaaatcaaagccctgatgatggagtctggcacaacgatggttggctaccagcctcagggg
gacaaggccaactttttccggatggtcatctcgaacccagctgctacacagtctgatatt
gacttcctcattgaggagatagaaagactgggccaggatctgtaa

DBGET integrated database retrieval system